BLASTX nr result
ID: Sinomenium21_contig00007625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00007625 (247 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002889598.1| acyl-CoA oxidase 6 [Arabidopsis lyrata subsp... 65 1e-08 gb|ABB83366.1| putative medium chain acyl-CoA oxidase [Malus dom... 62 6e-08 ref|XP_006417937.1| hypothetical protein EUTSA_v10006988mg [Eutr... 62 1e-07 ref|XP_007213790.1| hypothetical protein PRUPE_ppa002439m1g, par... 61 1e-07 gb|AFQ93695.1| acyl-CoA oxidase 3 [Prunus persica] 61 1e-07 gb|AAF73843.1|AF207994_1 acyl-CoA oxidase ACX3 [Arabidopsis thal... 60 3e-07 ref|XP_002889597.1| acyl-CoA oxidase ACX3 [Arabidopsis lyrata su... 60 3e-07 ref|XP_004303096.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxi... 60 4e-07 ref|NP_172120.2| putative acyl-CoA oxidase [Arabidopsis thaliana... 59 5e-07 ref|XP_007132685.1| hypothetical protein PHAVU_011G116000g [Phas... 59 5e-07 ref|XP_006364108.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxi... 59 7e-07 ref|XP_006306351.1| hypothetical protein CARUB_v10012245mg [Caps... 59 7e-07 ref|XP_004248184.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxi... 59 7e-07 gb|AAF80226.1|AC025290_15 Contains similarity to an acyl-coenzym... 59 7e-07 ref|NP_172119.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana... 59 7e-07 ref|XP_006446734.1| hypothetical protein CICLE_v10014502mg [Citr... 58 1e-06 ref|XP_006592447.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxi... 57 2e-06 ref|XP_006376402.1| acyl-CoA oxidase family protein [Populus tri... 57 2e-06 ref|XP_003539950.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxi... 57 2e-06 ref|XP_006469060.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxi... 57 3e-06 >ref|XP_002889598.1| acyl-CoA oxidase 6 [Arabidopsis lyrata subsp. lyrata] gi|297335440|gb|EFH65857.1| acyl-CoA oxidase 6 [Arabidopsis lyrata subsp. lyrata] Length = 675 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 142 VCLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 VCLQYS PE++E+ FDV+EMRKL+DGHNLEDRDW Sbjct: 33 VCLQYSPPELNERYGFDVKEMRKLLDGHNLEDRDW 67 >gb|ABB83366.1| putative medium chain acyl-CoA oxidase [Malus domestica] Length = 674 Score = 62.4 bits (150), Expect = 6e-08 Identities = 31/57 (54%), Positives = 36/57 (63%) Frame = +1 Query: 76 VLSRHLHQPXXXXXXXXXXXXXVCLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 VLS HL+QP CL +S PE+SE EFD +EMRKL+D HNLEDRDW Sbjct: 10 VLSNHLNQPSWSSNPLSPNP---CLGFSPPELSEPFEFDTKEMRKLLDAHNLEDRDW 63 >ref|XP_006417937.1| hypothetical protein EUTSA_v10006988mg [Eutrema salsugineum] gi|557095708|gb|ESQ36290.1| hypothetical protein EUTSA_v10006988mg [Eutrema salsugineum] Length = 675 Score = 61.6 bits (148), Expect = 1e-07 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = +1 Query: 142 VCLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 VCLQYS PE++E F+V+EMRKL+DGHN+EDRDW Sbjct: 33 VCLQYSPPELNESYGFEVKEMRKLLDGHNMEDRDW 67 >ref|XP_007213790.1| hypothetical protein PRUPE_ppa002439m1g, partial [Prunus persica] gi|462409655|gb|EMJ14989.1| hypothetical protein PRUPE_ppa002439m1g, partial [Prunus persica] Length = 151 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/57 (52%), Positives = 36/57 (63%) Frame = +1 Query: 76 VLSRHLHQPXXXXXXXXXXXXXVCLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 VLS HL+QP C+ +S PE+SE EFD +EMRKL+D HNLEDRDW Sbjct: 10 VLSNHLNQPSMSSPLSPNP----CVGFSPPELSEPFEFDTKEMRKLLDAHNLEDRDW 62 >gb|AFQ93695.1| acyl-CoA oxidase 3 [Prunus persica] Length = 672 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/57 (52%), Positives = 36/57 (63%) Frame = +1 Query: 76 VLSRHLHQPXXXXXXXXXXXXXVCLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 VLS HL+QP C+ +S PE+SE EFD +EMRKL+D HNLEDRDW Sbjct: 10 VLSNHLNQPSMSSPLSPNP----CVGFSPPELSEPFEFDTKEMRKLLDAHNLEDRDW 62 >gb|AAF73843.1|AF207994_1 acyl-CoA oxidase ACX3 [Arabidopsis thaliana] Length = 675 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 142 VCLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 VCLQYS PE++E FDV+EMRKL+DGHN+ DRDW Sbjct: 33 VCLQYSPPELNESYGFDVKEMRKLLDGHNVVDRDW 67 >ref|XP_002889597.1| acyl-CoA oxidase ACX3 [Arabidopsis lyrata subsp. lyrata] gi|297335439|gb|EFH65856.1| acyl-CoA oxidase ACX3 [Arabidopsis lyrata subsp. lyrata] Length = 675 Score = 60.1 bits (144), Expect = 3e-07 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +1 Query: 142 VCLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 VCLQYS PE++E FDV+EMRKL+DGHN+ DRDW Sbjct: 33 VCLQYSPPELNENYGFDVKEMRKLLDGHNVVDRDW 67 >ref|XP_004303096.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Fragaria vesca subsp. vesca] Length = 674 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/57 (50%), Positives = 36/57 (63%) Frame = +1 Query: 76 VLSRHLHQPXXXXXXXXXXXXXVCLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 VLS HLH+P CL YS PE++E EF+ +EMRKL+D HNLE+RDW Sbjct: 10 VLSNHLHRPAASSALTANP----CLGYSPPELTEPFEFNTKEMRKLLDHHNLEERDW 62 >ref|NP_172120.2| putative acyl-CoA oxidase [Arabidopsis thaliana] gi|62286635|sp|Q9LMI7.1|ACO32_ARATH RecName: Full=Putative acyl-coenzyme A oxidase 3.2, peroxisomal; Flags: Precursor gi|8927669|gb|AAF82160.1|AC068143_2 Contains similarity to an acyl-CoA oxidase (ASX2) mRNA from Arabidopsis thaliana gb|AF057043 and contains an acyl-CoA oxidase PF|01756 domain [Arabidopsis thaliana] gi|332189852|gb|AEE27973.1| acyl-CoA oxidase [Arabidopsis thaliana] Length = 675 Score = 59.3 bits (142), Expect = 5e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 142 VCLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 VC QYS PE++E F+V+EMRKL+DGHNLE+RDW Sbjct: 33 VCFQYSPPELNESYGFEVKEMRKLLDGHNLEERDW 67 >ref|XP_007132685.1| hypothetical protein PHAVU_011G116000g [Phaseolus vulgaris] gi|561005685|gb|ESW04679.1| hypothetical protein PHAVU_011G116000g [Phaseolus vulgaris] Length = 674 Score = 59.3 bits (142), Expect = 5e-07 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = +1 Query: 145 CLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 CL YS PE+S FD REMR+LMDGHNLEDRDW Sbjct: 32 CLSYSPPELSNDFAFDAREMRRLMDGHNLEDRDW 65 >ref|XP_006364108.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform X1 [Solanum tuberosum] Length = 685 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/58 (53%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = +1 Query: 76 VLSRHLHQPXXXXXXXXXXXXXVCLQYSAPEVSEKSE-FDVREMRKLMDGHNLEDRDW 246 VLSRHL Q CL Y+ PE+SE + FD++EMRKLMDGHNLE+RDW Sbjct: 20 VLSRHLKQETPTLNVILQSFP--CLSYNPPELSEPAAVFDIKEMRKLMDGHNLEERDW 75 >ref|XP_006306351.1| hypothetical protein CARUB_v10012245mg [Capsella rubella] gi|482575062|gb|EOA39249.1| hypothetical protein CARUB_v10012245mg [Capsella rubella] Length = 675 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 142 VCLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 +CLQYS PE++E FDV+EMRKL+DGHN+ DRDW Sbjct: 33 ICLQYSPPELNEICGFDVKEMRKLLDGHNVVDRDW 67 >ref|XP_004248184.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform 1 [Solanum lycopersicum] Length = 686 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/58 (53%), Positives = 37/58 (63%), Gaps = 1/58 (1%) Frame = +1 Query: 76 VLSRHLHQPXXXXXXXXXXXXXVCLQYSAPEVSEKSE-FDVREMRKLMDGHNLEDRDW 246 VLSRHL Q CL Y+ PE+SE + FD++EMRKLMDGHNLE+RDW Sbjct: 21 VLSRHLKQETPTLNVILQSLP--CLSYNPPELSETAAVFDIKEMRKLMDGHNLEERDW 76 >gb|AAF80226.1|AC025290_15 Contains similarity to an acyl-coenzyme A oxidase I precursor from Candida tropicalis gb|M12161 [Arabidopsis thaliana] Length = 305 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 142 VCLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 +CLQYS PE++E FDV+EMRKL+DGHN+ DRDW Sbjct: 33 LCLQYSPPELNESYGFDVKEMRKLLDGHNVVDRDW 67 >ref|NP_172119.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana] gi|342161829|sp|P0CZ23.1|ACOX3_ARATH RecName: Full=Acyl-coenzyme A oxidase 3, peroxisomal; Short=AOX 3; Short=Acyl-CoA oxidase 3; AltName: Full=Medium-chain acyl-CoA oxidase; Short=AtCX3; Flags: Precursor gi|8515709|gb|AAF76137.1|AF253474_1 acyl-CoA oxidase [Arabidopsis thaliana] gi|20466227|gb|AAM20431.1| acyl-CoA oxidase ACX3 [Arabidopsis thaliana] gi|30725500|gb|AAP37772.1| At1g06290 [Arabidopsis thaliana] gi|51970656|dbj|BAD44020.1| hypothetical protein [Arabidopsis thaliana] gi|332189851|gb|AEE27972.1| acyl-coenzyme A oxidase 3 [Arabidopsis thaliana] Length = 675 Score = 58.9 bits (141), Expect = 7e-07 Identities = 24/35 (68%), Positives = 30/35 (85%) Frame = +1 Query: 142 VCLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 +CLQYS PE++E FDV+EMRKL+DGHN+ DRDW Sbjct: 33 LCLQYSPPELNESYGFDVKEMRKLLDGHNVVDRDW 67 >ref|XP_006446734.1| hypothetical protein CICLE_v10014502mg [Citrus clementina] gi|557549345|gb|ESR59974.1| hypothetical protein CICLE_v10014502mg [Citrus clementina] Length = 671 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/57 (45%), Positives = 36/57 (63%) Frame = +1 Query: 76 VLSRHLHQPXXXXXXXXXXXXXVCLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 ++ HL QP CL YS PE++E +FD++EMRKL+DGHNL++RDW Sbjct: 10 IIKNHLLQPNSDQILTTN----ACLSYSPPELNEVYDFDLKEMRKLLDGHNLQERDW 62 >ref|XP_006592447.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform X2 [Glycine max] Length = 584 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = +1 Query: 145 CLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 CL YS PE+S FD REMRKLMD HNLEDRDW Sbjct: 33 CLSYSPPELSNTISFDTREMRKLMDCHNLEDRDW 66 >ref|XP_006376402.1| acyl-CoA oxidase family protein [Populus trichocarpa] gi|550325678|gb|ERP54199.1| acyl-CoA oxidase family protein [Populus trichocarpa] Length = 673 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +1 Query: 145 CLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 CL YS PE++E +FD++EMRK++D HNLEDRDW Sbjct: 37 CLSYSPPELTESFDFDIKEMRKILDFHNLEDRDW 70 >ref|XP_003539950.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like isoform X1 [Glycine max] Length = 675 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/34 (73%), Positives = 26/34 (76%) Frame = +1 Query: 145 CLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 CL YS PE+S FD REMRKLMD HNLEDRDW Sbjct: 33 CLSYSPPELSNTISFDTREMRKLMDCHNLEDRDW 66 >ref|XP_006469060.1| PREDICTED: acyl-coenzyme A oxidase 3, peroxisomal-like [Citrus sinensis] Length = 671 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/57 (43%), Positives = 36/57 (63%) Frame = +1 Query: 76 VLSRHLHQPXXXXXXXXXXXXXVCLQYSAPEVSEKSEFDVREMRKLMDGHNLEDRDW 246 ++ HL QP CL YS PE++E +FD++EMRKL+DGHNL+++DW Sbjct: 10 IIKNHLLQPNSDQILTTN----ACLSYSPPELNEVYDFDLKEMRKLLDGHNLQEQDW 62