BLASTX nr result
ID: Sinomenium21_contig00007349
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00007349 (289 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531294.1| conserved hypothetical protein [Ricinus comm... 57 3e-06 >ref|XP_002531294.1| conserved hypothetical protein [Ricinus communis] gi|223529127|gb|EEF31107.1| conserved hypothetical protein [Ricinus communis] Length = 149 Score = 56.6 bits (135), Expect = 3e-06 Identities = 27/39 (69%), Positives = 30/39 (76%) Frame = -3 Query: 287 EFESELKKEPDPAIEQPAEKPTTVSEEKKQEAAKFSSAE 171 EFESELKKEPD A+E P E PT +SEEKKQ+A SS E Sbjct: 109 EFESELKKEPDSALESPGETPTAISEEKKQDAEVSSSKE 147