BLASTX nr result
ID: Sinomenium21_contig00006741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00006741 (443 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530954.1| Protein grpE, putative [Ricinus communis] gi... 67 3e-09 ref|XP_006484785.1| PREDICTED: grpE protein homolog, mitochondri... 63 4e-08 ref|XP_002319738.1| co-chaperone grpE family protein [Populus tr... 63 4e-08 ref|XP_007202333.1| hypothetical protein PRUPE_ppa008162mg [Prun... 63 5e-08 ref|XP_006437270.1| hypothetical protein CICLE_v10031794mg [Citr... 61 1e-07 ref|XP_006339226.1| PREDICTED: grpE protein homolog, mitochondri... 60 3e-07 ref|XP_004249350.1| PREDICTED: protein GrpE-like [Solanum lycope... 57 2e-06 ref|XP_003624768.1| Protein grpE [Medicago truncatula] gi|355499... 57 2e-06 ref|XP_007161911.1| hypothetical protein PHAVU_001G108000g [Phas... 57 3e-06 ref|XP_003554067.1| PREDICTED: grpE protein homolog, mitochondri... 57 3e-06 ref|XP_004953075.1| PREDICTED: grpE protein homolog, mitochondri... 55 8e-06 dbj|BAD19686.1| putative co-chaperone CGE1 precursor isoform b [... 55 8e-06 ref|NP_001047409.2| Os02g0612000 [Oryza sativa Japonica Group] g... 55 8e-06 gb|EEE57358.1| hypothetical protein OsJ_07499 [Oryza sativa Japo... 55 8e-06 gb|EEC73579.1| hypothetical protein OsI_08039 [Oryza sativa Indi... 55 8e-06 >ref|XP_002530954.1| Protein grpE, putative [Ricinus communis] gi|223529469|gb|EEF31426.1| Protein grpE, putative [Ricinus communis] Length = 356 Score = 66.6 bits (161), Expect = 3e-09 Identities = 34/49 (69%), Positives = 37/49 (75%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKPKVDEPSEEAERDGETSKVDSAEVES 147 FK+GDRLLRPSMVKVSAGPGP KP+ E S E E GETS+ S E ES Sbjct: 306 FKLGDRLLRPSMVKVSAGPGPAKPEQAESSAEVETAGETSQEGSPEPES 354 >ref|XP_006484785.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X1 [Citrus sinensis] Length = 344 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/49 (63%), Positives = 37/49 (75%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKPKVDEPSEEAERDGETSKVDSAEVES 147 FK+GDRLLRPSMVKVSAGPGP KPK ++PSE ET+ + EVE+ Sbjct: 293 FKLGDRLLRPSMVKVSAGPGPAKPKEEQPSEGEAAVVETADSSTEEVEA 341 >ref|XP_002319738.1| co-chaperone grpE family protein [Populus trichocarpa] gi|222858114|gb|EEE95661.1| co-chaperone grpE family protein [Populus trichocarpa] Length = 342 Score = 63.2 bits (152), Expect = 4e-08 Identities = 34/50 (68%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKP-KVDEPSEEAERDGETSKVDSAEVES 147 FK+GDRLLRPSMVKVSAGPGP KP +V+E EEAE TS+ S E ES Sbjct: 292 FKLGDRLLRPSMVKVSAGPGPVKPEQVEESQEEAEATSGTSEGGSTEEES 341 >ref|XP_007202333.1| hypothetical protein PRUPE_ppa008162mg [Prunus persica] gi|462397864|gb|EMJ03532.1| hypothetical protein PRUPE_ppa008162mg [Prunus persica] Length = 343 Score = 62.8 bits (151), Expect = 5e-08 Identities = 31/49 (63%), Positives = 34/49 (69%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKPKVDEPSEEAERDGETSKVDSAEVES 147 FK+GDRLLRPSMVKVSAGPGP KP P E + ET+K S E ES Sbjct: 294 FKLGDRLLRPSMVKVSAGPGPAKPDQQVPPSEEQDASETTKEGSTETES 342 >ref|XP_006437270.1| hypothetical protein CICLE_v10031794mg [Citrus clementina] gi|557539466|gb|ESR50510.1| hypothetical protein CICLE_v10031794mg [Citrus clementina] Length = 387 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/49 (61%), Positives = 37/49 (75%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKPKVDEPSEEAERDGETSKVDSAEVES 147 FK+G+RLLRPSMVKVSAGPGP KPK ++PSE ET+ + EVE+ Sbjct: 336 FKLGNRLLRPSMVKVSAGPGPAKPKEEQPSEGEAAVVETADSSTEEVEA 384 >ref|XP_006339226.1| PREDICTED: grpE protein homolog, mitochondrial-like [Solanum tuberosum] Length = 357 Score = 60.1 bits (144), Expect = 3e-07 Identities = 31/54 (57%), Positives = 35/54 (64%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKPKVDEPSEEAERDGETSKVDSAEVEST*HVP 162 FK+GDRLLRPSMVKVSAGPGP KP+ EP EE E ++ D E T P Sbjct: 299 FKLGDRLLRPSMVKVSAGPGPAKPETTEPKEE-----EHNETDEKSEEGTAETP 347 >ref|XP_004249350.1| PREDICTED: protein GrpE-like [Solanum lycopersicum] Length = 352 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/48 (58%), Positives = 35/48 (72%), Gaps = 2/48 (4%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKPKVDEP--SEEAERDGETSKVDSAE 138 F++GDRLLRPSMVKVSAGPGP KP+ EP E+ E D +T++ E Sbjct: 298 FRLGDRLLRPSMVKVSAGPGPAKPETTEPKEKEQIETDEKTAETPGDE 345 >ref|XP_003624768.1| Protein grpE [Medicago truncatula] gi|355499783|gb|AES80986.1| Protein grpE [Medicago truncatula] Length = 335 Score = 57.4 bits (137), Expect = 2e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKPKVDEPSEEAERDGETSK 123 FK+GDRLLRPSMVKVSAGPGP KP+ + P EE E ETS+ Sbjct: 282 FKLGDRLLRPSMVKVSAGPGPAKPEQEVPQEE-EVTNETSQ 321 >ref|XP_007161911.1| hypothetical protein PHAVU_001G108000g [Phaseolus vulgaris] gi|561035375|gb|ESW33905.1| hypothetical protein PHAVU_001G108000g [Phaseolus vulgaris] Length = 333 Score = 56.6 bits (135), Expect = 3e-06 Identities = 30/48 (62%), Positives = 38/48 (79%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKPKVDEPSEEAERDGETSKVDSAEVE 144 FK+GDRLLRPSMVKVSAGPGP KP+ + P E+ + + E S+ DS E+E Sbjct: 280 FKLGDRLLRPSMVKVSAGPGPAKPEQEAPQED-KVNTEISE-DSKEIE 325 >ref|XP_003554067.1| PREDICTED: grpE protein homolog, mitochondrial-like isoform X1 [Glycine max] Length = 338 Score = 56.6 bits (135), Expect = 3e-06 Identities = 29/51 (56%), Positives = 34/51 (66%), Gaps = 2/51 (3%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKPKVDEPSEEAERD--GETSKVDSAEVES 147 FK+GDRLLRPSMVKVSAGPGP KP+ + P EE E SK + E+ Sbjct: 285 FKLGDRLLRPSMVKVSAGPGPAKPEQEAPQEEQVNTEISEDSKENEGSTET 335 >ref|XP_004953075.1| PREDICTED: grpE protein homolog, mitochondrial-like [Setaria italica] Length = 326 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/46 (60%), Positives = 32/46 (69%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKPKVDEPSEEAERDGETSKVDSAE 138 FK+G+RLLRP+MVKVSAGPGPEK DE E E KV+ AE Sbjct: 274 FKLGERLLRPAMVKVSAGPGPEKSGDDEDPTEVEDSVAPLKVEDAE 319 >dbj|BAD19686.1| putative co-chaperone CGE1 precursor isoform b [Oryza sativa Japonica Group] Length = 332 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/48 (58%), Positives = 34/48 (70%), Gaps = 11/48 (22%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKPKVDEPS-----------EEAERDG 111 FK+G+RLLRP+MVKVSAGPGPEKP D+P+ +EAE DG Sbjct: 278 FKLGERLLRPAMVKVSAGPGPEKPVYDDPAMVEDSVAPQKVKEAEDDG 325 >ref|NP_001047409.2| Os02g0612000 [Oryza sativa Japonica Group] gi|255671082|dbj|BAF09323.2| Os02g0612000, partial [Oryza sativa Japonica Group] Length = 89 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/48 (58%), Positives = 34/48 (70%), Gaps = 11/48 (22%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKPKVDEPS-----------EEAERDG 111 FK+G+RLLRP+MVKVSAGPGPEKP D+P+ +EAE DG Sbjct: 35 FKLGERLLRPAMVKVSAGPGPEKPVYDDPAMVEDSVAPQKVKEAEDDG 82 >gb|EEE57358.1| hypothetical protein OsJ_07499 [Oryza sativa Japonica Group] Length = 332 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/48 (58%), Positives = 34/48 (70%), Gaps = 11/48 (22%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKPKVDEPS-----------EEAERDG 111 FK+G+RLLRP+MVKVSAGPGPEKP D+P+ +EAE DG Sbjct: 278 FKLGERLLRPAMVKVSAGPGPEKPVYDDPAMVEDSVAPQKVKEAEDDG 325 >gb|EEC73579.1| hypothetical protein OsI_08039 [Oryza sativa Indica Group] Length = 332 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/48 (58%), Positives = 34/48 (70%), Gaps = 11/48 (22%) Frame = +1 Query: 1 FKIGDRLLRPSMVKVSAGPGPEKPKVDEPS-----------EEAERDG 111 FK+G+RLLRP+MVKVSAGPGPEKP D+P+ +EAE DG Sbjct: 278 FKLGERLLRPAMVKVSAGPGPEKPVYDDPAMVEDSVAPQKVKEAEDDG 325