BLASTX nr result
ID: Sinomenium21_contig00006364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00006364 (1223 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFG49534.1| hypothetical protein 2_4066_01, partial [Pinus ta... 54 4e-10 gb|AEW08240.1| hypothetical protein 2_4066_01, partial [Pinus ra... 54 4e-10 gb|ADC55527.1| ERF transcription factor [Camellia sinensis] 42 3e-07 ref|XP_002279585.1| PREDICTED: ethylene-responsive transcription... 42 3e-07 ref|XP_006365341.1| PREDICTED: ethylene-responsive transcription... 42 6e-07 ref|XP_004239983.1| PREDICTED: ethylene-responsive transcription... 42 6e-07 gb|AAC50047.1| Pti4 [Solanum lycopersicum] 42 6e-07 ref|NP_001275437.1| Pti4 [Solanum tuberosum] gi|194360387|gb|ACF... 42 6e-07 ref|NP_001275603.1| ethylene-responsive transcription factor 1-l... 42 8e-07 gb|EYU20174.1| hypothetical protein MIMGU_mgv1a018364mg [Mimulus... 42 8e-07 emb|CBJ55933.1| ethylene response factor 2.2 [Bupleurum kaoi] 42 8e-07 dbj|BAN45684.1| ethylene response factor [Nicotiana umbratica] 42 8e-07 gb|AGB07589.1| ethylene-responsive transcription factor 6 [Artem... 40 1e-06 sp|Q84XB3.1|ERF1_SOLLC RecName: Full=Ethylene-responsive transcr... 42 1e-06 ref|XP_004235186.1| PREDICTED: ethylene-responsive transcription... 42 1e-06 ref|XP_006421523.1| hypothetical protein CICLE_v10005891mg [Citr... 42 6e-06 gb|EPS69901.1| ethylene-responsive transcription factor 2, parti... 39 6e-06 gb|EPS62607.1| hypothetical protein M569_12181, partial [Genlise... 40 6e-06 ref|XP_006477125.1| PREDICTED: ethylene-responsive transcription... 40 8e-06 ref|XP_006440234.1| hypothetical protein CICLE_v10021652mg [Citr... 40 8e-06 >gb|AFG49534.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136881|gb|AFG49535.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136883|gb|AFG49536.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136885|gb|AFG49537.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136887|gb|AFG49538.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136889|gb|AFG49539.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136891|gb|AFG49540.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136893|gb|AFG49541.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136895|gb|AFG49542.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136897|gb|AFG49543.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136899|gb|AFG49544.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136901|gb|AFG49545.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136903|gb|AFG49546.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136905|gb|AFG49547.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136907|gb|AFG49548.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136909|gb|AFG49549.1| hypothetical protein 2_4066_01, partial [Pinus taeda] gi|383136911|gb|AFG49550.1| hypothetical protein 2_4066_01, partial [Pinus taeda] Length = 134 Score = 54.3 bits (129), Expect(2) = 4e-10 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQPIEP 976 LPLDENDS+DM LYGVLKEAT +GW P+ P Sbjct: 22 LPLDENDSQDMFLYGVLKEATQKGWTPLTP 51 Score = 38.1 bits (87), Expect(2) = 4e-10 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 GRH+RGVR RPWGK+AA Sbjct: 81 GRHFRGVRRRPWGKYAA 97 >gb|AEW08240.1| hypothetical protein 2_4066_01, partial [Pinus radiata] Length = 134 Score = 54.3 bits (129), Expect(2) = 4e-10 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQPIEP 976 LPLDENDS+DM LYGVLKEAT +GW P+ P Sbjct: 22 LPLDENDSQDMFLYGVLKEATQKGWTPLTP 51 Score = 38.1 bits (87), Expect(2) = 4e-10 Identities = 14/17 (82%), Positives = 16/17 (94%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 GRH+RGVR RPWGK+AA Sbjct: 81 GRHFRGVRRRPWGKYAA 97 >gb|ADC55527.1| ERF transcription factor [Camellia sinensis] Length = 212 Score = 42.4 bits (98), Expect(2) = 3e-07 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQP 967 LPL ENDSEDM++YG+L EA GW P Sbjct: 47 LPLKENDSEDMLVYGLLNEAATVGWLP 73 Score = 40.4 bits (93), Expect(2) = 3e-07 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 G+HYRGVR+RPWGKFAA Sbjct: 106 GKHYRGVRQRPWGKFAA 122 >ref|XP_002279585.1| PREDICTED: ethylene-responsive transcription factor 2-like [Vitis vinifera] Length = 235 Score = 41.6 bits (96), Expect(2) = 3e-07 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 GRHYRGVR+RPWGKFAA Sbjct: 108 GRHYRGVRQRPWGKFAA 124 Score = 40.8 bits (94), Expect(2) = 3e-07 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQP 967 LPL +DSEDMVLYGVL++A GW P Sbjct: 50 LPLKVDDSEDMVLYGVLRDAVSVGWTP 76 >ref|XP_006365341.1| PREDICTED: ethylene-responsive transcription factor 1-like [Solanum tuberosum] Length = 270 Score = 41.6 bits (96), Expect(2) = 6e-07 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 GRHYRGVR+RPWGKFAA Sbjct: 139 GRHYRGVRQRPWGKFAA 155 Score = 40.0 bits (92), Expect(2) = 6e-07 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQP 967 LPL +DSEDMV+YG+LK+A GW P Sbjct: 73 LPLKVDDSEDMVIYGLLKDALSVGWSP 99 >ref|XP_004239983.1| PREDICTED: ethylene-responsive transcription factor 1 [Solanum lycopersicum] Length = 234 Score = 41.6 bits (96), Expect(2) = 6e-07 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 GRHYRGVR+RPWGKFAA Sbjct: 103 GRHYRGVRQRPWGKFAA 119 Score = 40.0 bits (92), Expect(2) = 6e-07 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQP 967 LPL +DSEDMV+YG+LK+A GW P Sbjct: 37 LPLKVDDSEDMVIYGLLKDALSVGWSP 63 >gb|AAC50047.1| Pti4 [Solanum lycopersicum] Length = 234 Score = 41.6 bits (96), Expect(2) = 6e-07 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 GRHYRGVR+RPWGKFAA Sbjct: 103 GRHYRGVRQRPWGKFAA 119 Score = 40.0 bits (92), Expect(2) = 6e-07 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQP 967 LPL +DSEDMV+YG+LK+A GW P Sbjct: 37 LPLKVDDSEDMVIYGLLKDALSVGWSP 63 >ref|NP_001275437.1| Pti4 [Solanum tuberosum] gi|194360387|gb|ACF57857.1| Pti4 [Solanum tuberosum] Length = 234 Score = 41.6 bits (96), Expect(2) = 6e-07 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 GRHYRGVR+RPWGKFAA Sbjct: 103 GRHYRGVRQRPWGKFAA 119 Score = 40.0 bits (92), Expect(2) = 6e-07 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQP 967 LPL +DSEDMV+YG+LK+A GW P Sbjct: 37 LPLKVDDSEDMVIYGLLKDALSVGWSP 63 >ref|NP_001275603.1| ethylene-responsive transcription factor 1-like [Solanum tuberosum] gi|145077169|gb|ABP35567.1| ERF transcription factor [Solanum tuberosum] Length = 247 Score = 41.6 bits (96), Expect(2) = 8e-07 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 GRHYRGVR+RPWGKFAA Sbjct: 109 GRHYRGVRQRPWGKFAA 125 Score = 39.7 bits (91), Expect(2) = 8e-07 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQP 967 LPL NDSEDMV+YG+L++A GW P Sbjct: 42 LPLKVNDSEDMVIYGLLQDAFSIGWTP 68 >gb|EYU20174.1| hypothetical protein MIMGU_mgv1a018364mg [Mimulus guttatus] Length = 243 Score = 41.6 bits (96), Expect(2) = 8e-07 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 GRHYRGVR+RPWGKFAA Sbjct: 101 GRHYRGVRQRPWGKFAA 117 Score = 39.7 bits (91), Expect(2) = 8e-07 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQP 967 LPL +DSEDMV+YG+L++A GW P Sbjct: 38 LPLKVDDSEDMVIYGLLRDAVTDGWTP 64 >emb|CBJ55933.1| ethylene response factor 2.2 [Bupleurum kaoi] Length = 233 Score = 41.6 bits (96), Expect(2) = 8e-07 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 GRHYRGVR+RPWGKFAA Sbjct: 97 GRHYRGVRQRPWGKFAA 113 Score = 39.7 bits (91), Expect(2) = 8e-07 Identities = 16/27 (59%), Positives = 20/27 (74%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQP 967 LPL E+DSEDMV+Y L++A GW P Sbjct: 31 LPLKEDDSEDMVIYNFLRDAVTAGWTP 57 >dbj|BAN45684.1| ethylene response factor [Nicotiana umbratica] Length = 216 Score = 41.6 bits (96), Expect(2) = 8e-07 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 GRHYRGVR+RPWGKFAA Sbjct: 79 GRHYRGVRQRPWGKFAA 95 Score = 39.7 bits (91), Expect(2) = 8e-07 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQPIE 973 LPL +DSEDMV+YG+L +A GW P + Sbjct: 11 LPLKVDDSEDMVIYGLLSDALTTGWTPFD 39 >gb|AGB07589.1| ethylene-responsive transcription factor 6 [Artemisia annua] Length = 207 Score = 40.4 bits (93), Expect(2) = 1e-06 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQP 967 LPL NDS+DMV+YG+L++A GW P Sbjct: 30 LPLKVNDSDDMVIYGILRDAVSVGWTP 56 Score = 40.4 bits (93), Expect(2) = 1e-06 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 G+HYRGVR+RPWGKFAA Sbjct: 92 GKHYRGVRQRPWGKFAA 108 >sp|Q84XB3.1|ERF1_SOLLC RecName: Full=Ethylene-responsive transcription factor 1; Short=LeERF1; AltName: Full=ERF1-like protein; AltName: Full=Ethylene-responsive element-binding factor 1; Short=EREBP-1 gi|28274828|gb|AAO34703.1| ethylene response factor 1 [Solanum lycopersicum] Length = 244 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 GRHYRGVR+RPWGKFAA Sbjct: 104 GRHYRGVRQRPWGKFAA 120 Score = 38.9 bits (89), Expect(2) = 1e-06 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQP 967 LPL NDSEDMV+YG L++A GW P Sbjct: 40 LPLKVNDSEDMVIYGFLQDAFSIGWTP 66 >ref|XP_004235186.1| PREDICTED: ethylene-responsive transcription factor 1-like [Solanum lycopersicum] Length = 242 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 GRHYRGVR+RPWGKFAA Sbjct: 104 GRHYRGVRQRPWGKFAA 120 Score = 38.9 bits (89), Expect(2) = 1e-06 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQP 967 LPL NDSEDMV+YG L++A GW P Sbjct: 40 LPLKVNDSEDMVIYGFLQDAFSIGWTP 66 >ref|XP_006421523.1| hypothetical protein CICLE_v10005891mg [Citrus clementina] gi|297375531|gb|ADI34108.1| putative ethylene-responsive element binding protein [Citrus unshiu] gi|557523396|gb|ESR34763.1| hypothetical protein CICLE_v10005891mg [Citrus clementina] Length = 207 Score = 41.6 bits (96), Expect(2) = 6e-06 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 GRHYRGVR+RPWGKFAA Sbjct: 94 GRHYRGVRQRPWGKFAA 110 Score = 36.6 bits (83), Expect(2) = 6e-06 Identities = 14/29 (48%), Positives = 20/29 (68%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQPIE 973 LPL NDSEDM+++ L +A GW P++ Sbjct: 35 LPLRVNDSEDMIIFNYLHDAVNSGWSPLD 63 >gb|EPS69901.1| ethylene-responsive transcription factor 2, partial [Genlisea aurea] Length = 179 Score = 39.3 bits (90), Expect(2) = 6e-06 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = +1 Query: 1072 RHYRGVRERPWGKFAA 1119 RHYRGVR+RPWGKFAA Sbjct: 83 RHYRGVRQRPWGKFAA 98 Score = 38.9 bits (89), Expect(2) = 6e-06 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQP 967 LPL +DSEDMV+YG+L++A GW P Sbjct: 22 LPLRVDDSEDMVIYGILRDALNDGWTP 48 >gb|EPS62607.1| hypothetical protein M569_12181, partial [Genlisea aurea] Length = 175 Score = 40.4 bits (93), Expect(2) = 6e-06 Identities = 17/27 (62%), Positives = 20/27 (74%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQP 967 LPL NDSEDMV+YG+L +A GW P Sbjct: 23 LPLRVNDSEDMVIYGLLNDAVNNGWTP 49 Score = 37.7 bits (86), Expect(2) = 6e-06 Identities = 14/16 (87%), Positives = 16/16 (100%) Frame = +1 Query: 1072 RHYRGVRERPWGKFAA 1119 RH+RGVR+RPWGKFAA Sbjct: 89 RHFRGVRQRPWGKFAA 104 >ref|XP_006477125.1| PREDICTED: ethylene-responsive transcription factor 1A-like [Citrus sinensis] Length = 271 Score = 40.4 bits (93), Expect(2) = 8e-06 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 G+HYRGVR+RPWGKFAA Sbjct: 136 GKHYRGVRQRPWGKFAA 152 Score = 37.4 bits (85), Expect(2) = 8e-06 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQPIE 973 LPL ENDSEDM+++ L++A GW P E Sbjct: 73 LPLRENDSEDMLVFNFLRDALTVGWVPQE 101 >ref|XP_006440234.1| hypothetical protein CICLE_v10021652mg [Citrus clementina] gi|557542496|gb|ESR53474.1| hypothetical protein CICLE_v10021652mg [Citrus clementina] Length = 271 Score = 40.4 bits (93), Expect(2) = 8e-06 Identities = 15/17 (88%), Positives = 17/17 (100%) Frame = +1 Query: 1069 GRHYRGVRERPWGKFAA 1119 G+HYRGVR+RPWGKFAA Sbjct: 136 GKHYRGVRQRPWGKFAA 152 Score = 37.4 bits (85), Expect(2) = 8e-06 Identities = 16/29 (55%), Positives = 21/29 (72%) Frame = +2 Query: 887 LPLDENDSEDMVLYGVLKEATLRGWQPIE 973 LPL ENDSEDM+++ L++A GW P E Sbjct: 73 LPLRENDSEDMLVFNFLRDALTVGWVPQE 101