BLASTX nr result
ID: Sinomenium21_contig00005504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00005504 (422 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004146515.1| PREDICTED: uncharacterized protein LOC101208... 58 2e-06 ref|XP_006425544.1| hypothetical protein CICLE_v10026225mg [Citr... 57 2e-06 ref|XP_007202417.1| hypothetical protein PRUPE_ppa009676mg [Prun... 57 2e-06 ref|XP_002531507.1| conserved hypothetical protein [Ricinus comm... 56 6e-06 ref|XP_006346985.1| PREDICTED: uncharacterized protein LOC102599... 55 8e-06 ref|XP_004233549.1| PREDICTED: uncharacterized protein LOC101249... 55 8e-06 >ref|XP_004146515.1| PREDICTED: uncharacterized protein LOC101208655 [Cucumis sativus] gi|449499948|ref|XP_004160962.1| PREDICTED: uncharacterized LOC101208655 [Cucumis sativus] Length = 279 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 420 PPIFRGLRSFEVTTSLITYVLLWVSSTYLK 331 PP+ +GLR FEVTTSLITY+LLWVSSTYLK Sbjct: 250 PPVIKGLRGFEVTTSLITYILLWVSSTYLK 279 >ref|XP_006425544.1| hypothetical protein CICLE_v10026225mg [Citrus clementina] gi|567865845|ref|XP_006425545.1| hypothetical protein CICLE_v10026225mg [Citrus clementina] gi|557527534|gb|ESR38784.1| hypothetical protein CICLE_v10026225mg [Citrus clementina] gi|557527535|gb|ESR38785.1| hypothetical protein CICLE_v10026225mg [Citrus clementina] Length = 282 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -3 Query: 417 PIFRGLRSFEVTTSLITYVLLWVSSTYLK 331 PI +GLRSFEVTTSLITYVLLWVSSTYLK Sbjct: 254 PIIKGLRSFEVTTSLITYVLLWVSSTYLK 282 >ref|XP_007202417.1| hypothetical protein PRUPE_ppa009676mg [Prunus persica] gi|462397948|gb|EMJ03616.1| hypothetical protein PRUPE_ppa009676mg [Prunus persica] Length = 282 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -3 Query: 420 PPIFRGLRSFEVTTSLITYVLLWVSSTYLK 331 PPI +G RSFEVTTSLITYVLLWVSSTYLK Sbjct: 253 PPILKGPRSFEVTTSLITYVLLWVSSTYLK 282 >ref|XP_002531507.1| conserved hypothetical protein [Ricinus communis] gi|223528860|gb|EEF30861.1| conserved hypothetical protein [Ricinus communis] Length = 318 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 417 PIFRGLRSFEVTTSLITYVLLWVSSTYLK 331 P +GLRSFEVTTSLITYVLLWVSSTYLK Sbjct: 290 PFIKGLRSFEVTTSLITYVLLWVSSTYLK 318 >ref|XP_006346985.1| PREDICTED: uncharacterized protein LOC102599146 [Solanum tuberosum] Length = 270 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 420 PPIFRGLRSFEVTTSLITYVLLWVSSTYL 334 PPIF+G RS EVTTSLITYVLLWVSSTYL Sbjct: 241 PPIFKGPRSLEVTTSLITYVLLWVSSTYL 269 >ref|XP_004233549.1| PREDICTED: uncharacterized protein LOC101249520 [Solanum lycopersicum] Length = 270 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 420 PPIFRGLRSFEVTTSLITYVLLWVSSTYL 334 PPIF+G RS EVTTSLITYVLLWVSSTYL Sbjct: 241 PPIFKGPRSLEVTTSLITYVLLWVSSTYL 269