BLASTX nr result
ID: Sinomenium21_contig00004979
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00004979 (1740 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera] 59 7e-06 >emb|CAN78447.1| hypothetical protein VITISV_026810 [Vitis vinifera] Length = 1171 Score = 58.9 bits (141), Expect = 7e-06 Identities = 31/66 (46%), Positives = 42/66 (63%), Gaps = 1/66 (1%) Frame = -3 Query: 928 KSIEHEQRTRYH*KTFSPIVKPTTICTTIRVSVHSNLIISQLYVKNIF-HSFLWEEVFMD 752 K + + YH +TFSP++KPTTI + ++VH + I QL V N F H FL EEVFM+ Sbjct: 878 KGYDQKSGVDYH-ETFSPVIKPTTIRLVLAIAVHFHWPIQQLDVSNAFLHGFLDEEVFME 936 Query: 751 QPPGLI 734 QP G + Sbjct: 937 QPRGFV 942