BLASTX nr result
ID: Sinomenium21_contig00004752
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00004752 (424 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006573266.1| PREDICTED: methionine aminopeptidase 1B, chl... 58 2e-06 ref|XP_003516850.1| PREDICTED: methionine aminopeptidase 1B, chl... 58 2e-06 gb|EYU29943.1| hypothetical protein MIMGU_mgv1a008750mg [Mimulus... 57 3e-06 ref|XP_004160592.1| PREDICTED: methionine aminopeptidase 1B, chl... 56 5e-06 ref|XP_004147182.1| PREDICTED: methionine aminopeptidase 1B, chl... 56 5e-06 ref|XP_002311439.2| hypothetical protein POPTR_0008s11610g [Popu... 56 6e-06 ref|XP_006855817.1| hypothetical protein AMTR_s00044p00231480 [A... 56 6e-06 ref|XP_007046301.1| Methionine aminopeptidase 1B isoform 1 [Theo... 56 6e-06 ref|XP_002524411.1| methionine aminopeptidase, putative [Ricinus... 56 6e-06 >ref|XP_006573266.1| PREDICTED: methionine aminopeptidase 1B, chloroplastic-like isoform X2 [Glycine max] Length = 298 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 422 WTTVTVDGSPAAQCEHTLLITKTGAEVLTK 333 WTT+T DGSPAAQ EHT+LITKTGAE+LTK Sbjct: 268 WTTITADGSPAAQFEHTILITKTGAEILTK 297 >ref|XP_003516850.1| PREDICTED: methionine aminopeptidase 1B, chloroplastic-like isoform X1 [Glycine max] Length = 366 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 422 WTTVTVDGSPAAQCEHTLLITKTGAEVLTK 333 WTT+T DGSPAAQ EHT+LITKTGAE+LTK Sbjct: 336 WTTITADGSPAAQFEHTILITKTGAEILTK 365 >gb|EYU29943.1| hypothetical protein MIMGU_mgv1a008750mg [Mimulus guttatus] gi|604318452|gb|EYU29944.1| hypothetical protein MIMGU_mgv1a008750mg [Mimulus guttatus] Length = 363 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 422 WTTVTVDGSPAAQCEHTLLITKTGAEVLTK 333 WTT+T DGSPAAQ EHT+LITKTGAE+LTK Sbjct: 333 WTTLTADGSPAAQFEHTILITKTGAEILTK 362 >ref|XP_004160592.1| PREDICTED: methionine aminopeptidase 1B, chloroplastic-like [Cucumis sativus] Length = 369 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 422 WTTVTVDGSPAAQCEHTLLITKTGAEVLTKP 330 WTT+T DGSPAAQ EHT+LIT+TGAE+LT P Sbjct: 339 WTTLTADGSPAAQFEHTILITRTGAEILTTP 369 >ref|XP_004147182.1| PREDICTED: methionine aminopeptidase 1B, chloroplastic-like [Cucumis sativus] Length = 369 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 422 WTTVTVDGSPAAQCEHTLLITKTGAEVLTKP 330 WTT+T DGSPAAQ EHT+LIT+TGAE+LT P Sbjct: 339 WTTLTADGSPAAQFEHTILITRTGAEILTTP 369 >ref|XP_002311439.2| hypothetical protein POPTR_0008s11610g [Populus trichocarpa] gi|550332867|gb|EEE88806.2| hypothetical protein POPTR_0008s11610g [Populus trichocarpa] Length = 365 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 422 WTTVTVDGSPAAQCEHTLLITKTGAEVLTK 333 WTT+T DGSPAAQ EHT+LIT+TGAE+LTK Sbjct: 335 WTTLTADGSPAAQFEHTILITRTGAEILTK 364 >ref|XP_006855817.1| hypothetical protein AMTR_s00044p00231480 [Amborella trichopoda] gi|548859604|gb|ERN17284.1| hypothetical protein AMTR_s00044p00231480 [Amborella trichopoda] Length = 360 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 422 WTTVTVDGSPAAQCEHTLLITKTGAEVLTK 333 WTT+T DGSPAAQ EHT+LIT+TGAE+LTK Sbjct: 330 WTTLTADGSPAAQFEHTILITRTGAEILTK 359 >ref|XP_007046301.1| Methionine aminopeptidase 1B isoform 1 [Theobroma cacao] gi|508710236|gb|EOY02133.1| Methionine aminopeptidase 1B isoform 1 [Theobroma cacao] Length = 369 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 422 WTTVTVDGSPAAQCEHTLLITKTGAEVLTK 333 WTT+T DGSPAAQ EHT+LIT+TGAE+LTK Sbjct: 339 WTTLTADGSPAAQFEHTILITRTGAEILTK 368 >ref|XP_002524411.1| methionine aminopeptidase, putative [Ricinus communis] gi|223536372|gb|EEF38022.1| methionine aminopeptidase, putative [Ricinus communis] Length = 365 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 422 WTTVTVDGSPAAQCEHTLLITKTGAEVLTK 333 WTT+T DGSPAAQ EHT+LIT+TGAE+LTK Sbjct: 335 WTTLTADGSPAAQFEHTILITRTGAEILTK 364