BLASTX nr result
ID: Sinomenium21_contig00004582
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00004582 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43677.1| hypothetical protein MIMGU_mgv1a002953mg [Mimulus... 59 9e-07 ref|XP_002276821.2| PREDICTED: uncharacterized protein At4g19900... 57 2e-06 >gb|EYU43677.1| hypothetical protein MIMGU_mgv1a002953mg [Mimulus guttatus] Length = 622 Score = 58.5 bits (140), Expect = 9e-07 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = +3 Query: 66 MFKALRGRRRPRYGAHLCAILAAVLLLFSVIFLHSHLGF 182 M + LR RRRPRYGAH+CA++AAVLLL SV LHS L F Sbjct: 1 MLRHLRSRRRPRYGAHVCALIAAVLLLLSVSLLHSRLSF 39 >ref|XP_002276821.2| PREDICTED: uncharacterized protein At4g19900-like [Vitis vinifera] Length = 707 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +3 Query: 66 MFKALRGRRRPRYGAHLCAILAAVLLLFSVIFLHSHLGFDR 188 M + LR RRRPRYGA +CA++AA+LLL SV LHS L F R Sbjct: 1 MLRTLRSRRRPRYGAQVCAVIAALLLLLSVTVLHSRLSFSR 41