BLASTX nr result
ID: Sinomenium21_contig00003737
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Sinomenium21_contig00003737 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABI51594.1| chloroplast post-illumination chlorophyll fluores... 104 1e-20 ref|XP_006346596.1| PREDICTED: uncharacterized protein LOC102579... 102 6e-20 ref|XP_004252316.1| PREDICTED: uncharacterized protein LOC101260... 100 2e-19 ref|XP_004252315.1| PREDICTED: uncharacterized protein LOC101260... 100 2e-19 gb|EXB67290.1| hypothetical protein L484_025772 [Morus notabilis] 96 5e-18 gb|EYU21652.1| hypothetical protein MIMGU_mgv1a011532mg [Mimulus... 90 4e-16 ref|XP_004163546.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 89 5e-16 ref|XP_004135851.1| PREDICTED: uncharacterized protein LOC101207... 89 5e-16 ref|XP_006298164.1| hypothetical protein CARUB_v10014215mg [Caps... 89 6e-16 ref|XP_002266165.1| PREDICTED: uncharacterized protein LOC100264... 89 6e-16 ref|XP_002298209.1| hypothetical protein POPTR_0001s21140g [Popu... 89 8e-16 gb|ABK95122.1| unknown [Populus trichocarpa] 89 8e-16 ref|XP_006465321.1| PREDICTED: uncharacterized protein LOC102621... 88 1e-15 ref|XP_006427293.1| hypothetical protein CICLE_v10026222mg [Citr... 88 1e-15 ref|XP_006427292.1| hypothetical protein CICLE_v10026222mg [Citr... 88 1e-15 ref|XP_004506951.1| PREDICTED: uncharacterized protein LOC101496... 88 1e-15 ref|NP_001030706.1| post-illumination chlorophyll fluorescence i... 88 1e-15 ref|NP_566528.1| post-illumination chlorophyll fluorescence incr... 88 1e-15 ref|NP_001189904.1| post-illumination chlorophyll fluorescence i... 88 1e-15 ref|XP_002885111.1| hypothetical protein ARALYDRAFT_897884 [Arab... 88 1e-15 >gb|ABI51594.1| chloroplast post-illumination chlorophyll fluorescence increase protein [Nicotiana tabacum] Length = 277 Score = 104 bits (259), Expect = 1e-20 Identities = 43/53 (81%), Positives = 52/53 (98%) Frame = -1 Query: 306 ITRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCPPFSDSEE 148 ITRCAM+GNL+VEGGDRC+LD+VPGC+DPSS +FNPLANVDDGSCPP+SD+E+ Sbjct: 225 ITRCAMVGNLSVEGGDRCDLDIVPGCIDPSSPYFNPLANVDDGSCPPYSDAED 277 >ref|XP_006346596.1| PREDICTED: uncharacterized protein LOC102579625 [Solanum tuberosum] Length = 277 Score = 102 bits (254), Expect = 6e-20 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -1 Query: 306 ITRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCPPFSDSEE 148 ITRCAM+GNL V+GGDRCNLDLVPGC+DP+S +NPLANVDDGSCPP+SDSEE Sbjct: 225 ITRCAMVGNLNVDGGDRCNLDLVPGCIDPNSPEYNPLANVDDGSCPPYSDSEE 277 >ref|XP_004252316.1| PREDICTED: uncharacterized protein LOC101260209 isoform 2 [Solanum lycopersicum] Length = 277 Score = 100 bits (250), Expect = 2e-19 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -1 Query: 306 ITRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCPPFSDSEE 148 ITRCAM+GNL V+GGDRCNLDLVPGC+DP S +NPLANVDDGSCPP+SDSE+ Sbjct: 225 ITRCAMVGNLNVDGGDRCNLDLVPGCIDPDSPQYNPLANVDDGSCPPYSDSED 277 >ref|XP_004252315.1| PREDICTED: uncharacterized protein LOC101260209 isoform 1 [Solanum lycopersicum] Length = 300 Score = 100 bits (250), Expect = 2e-19 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -1 Query: 306 ITRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCPPFSDSEE 148 ITRCAM+GNL V+GGDRCNLDLVPGC+DP S +NPLANVDDGSCPP+SDSE+ Sbjct: 248 ITRCAMVGNLNVDGGDRCNLDLVPGCIDPDSPQYNPLANVDDGSCPPYSDSED 300 >gb|EXB67290.1| hypothetical protein L484_025772 [Morus notabilis] Length = 283 Score = 95.9 bits (237), Expect = 5e-18 Identities = 42/52 (80%), Positives = 47/52 (90%) Frame = -1 Query: 306 ITRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCPPFSDSE 151 +TRCAMIGNL+VEGGDRCNL+LVPGC DPSS F+NPLANVDDGSCP +D E Sbjct: 231 VTRCAMIGNLSVEGGDRCNLNLVPGCTDPSSPFYNPLANVDDGSCPIDTDDE 282 >gb|EYU21652.1| hypothetical protein MIMGU_mgv1a011532mg [Mimulus guttatus] Length = 278 Score = 89.7 bits (221), Expect = 4e-16 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -1 Query: 303 TRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCPPFSDSE 151 T CAMIGNL +EGGDRCNLD+V GC DP S F+PLA VDDGSCPP+SDS+ Sbjct: 228 TTCAMIGNLTLEGGDRCNLDIVTGCTDPGSEMFDPLATVDDGSCPPYSDSD 278 >ref|XP_004163546.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101207565 [Cucumis sativus] Length = 284 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/53 (75%), Positives = 46/53 (86%) Frame = -1 Query: 306 ITRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCPPFSDSEE 148 +TRCAMIGNL VEGGDRC+L+LV GC DPSS FNPLANVDDGSCP +D+E+ Sbjct: 232 VTRCAMIGNLTVEGGDRCDLNLVLGCTDPSSHLFNPLANVDDGSCPIDTDTED 284 >ref|XP_004135851.1| PREDICTED: uncharacterized protein LOC101207565 [Cucumis sativus] Length = 284 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/53 (75%), Positives = 46/53 (86%) Frame = -1 Query: 306 ITRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCPPFSDSEE 148 +TRCAMIGNL VEGGDRC+L+LV GC DPSS FNPLANVDDGSCP +D+E+ Sbjct: 232 VTRCAMIGNLTVEGGDRCDLNLVLGCTDPSSHLFNPLANVDDGSCPIDTDTED 284 >ref|XP_006298164.1| hypothetical protein CARUB_v10014215mg [Capsella rubella] gi|482566873|gb|EOA31062.1| hypothetical protein CARUB_v10014215mg [Capsella rubella] Length = 316 Score = 89.0 bits (219), Expect = 6e-16 Identities = 42/53 (79%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = -1 Query: 303 TRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCP-PFSDSEE 148 TRC MI NL VEGGDRCNLDLVPGCMD +S FNP ANVDDGSCP SDSEE Sbjct: 264 TRCTMIANLTVEGGDRCNLDLVPGCMDTNSEHFNPYANVDDGSCPLELSDSEE 316 >ref|XP_002266165.1| PREDICTED: uncharacterized protein LOC100264489 isoform 1 [Vitis vinifera] gi|225442945|ref|XP_002266207.1| PREDICTED: uncharacterized protein LOC100264489 isoform 2 [Vitis vinifera] gi|297743467|emb|CBI36334.3| unnamed protein product [Vitis vinifera] Length = 282 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = -1 Query: 306 ITRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCPPFSDSEE 148 I RCA+IGNL +EGGDRCNLD V GC DPSS +NPLANVDDGSCP SDSE+ Sbjct: 230 IDRCALIGNLTLEGGDRCNLDFVIGCTDPSSPLYNPLANVDDGSCPIESDSED 282 >ref|XP_002298209.1| hypothetical protein POPTR_0001s21140g [Populus trichocarpa] gi|222845467|gb|EEE83014.1| hypothetical protein POPTR_0001s21140g [Populus trichocarpa] Length = 286 Score = 88.6 bits (218), Expect = 8e-16 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -1 Query: 306 ITRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCP 169 +TRCAMIGNL++EGGDRC+LDLV GCMDPSS +NPLANVDDG+CP Sbjct: 236 VTRCAMIGNLSIEGGDRCDLDLVSGCMDPSSHLYNPLANVDDGTCP 281 >gb|ABK95122.1| unknown [Populus trichocarpa] Length = 197 Score = 88.6 bits (218), Expect = 8e-16 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -1 Query: 306 ITRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCP 169 +TRCAMIGNL++EGGDRC+LDLV GCMDPSS +NPLANVDDG+CP Sbjct: 147 VTRCAMIGNLSIEGGDRCDLDLVSGCMDPSSHLYNPLANVDDGTCP 192 >ref|XP_006465321.1| PREDICTED: uncharacterized protein LOC102621225 [Citrus sinensis] Length = 283 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/53 (71%), Positives = 45/53 (84%) Frame = -1 Query: 306 ITRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCPPFSDSEE 148 + RC +IGNLA EGGDRC+L+LVPGCMDPSS ++PLANVDDGSCP SD E+ Sbjct: 231 VDRCVLIGNLAAEGGDRCDLNLVPGCMDPSSPLYDPLANVDDGSCPLDSDIED 283 >ref|XP_006427293.1| hypothetical protein CICLE_v10026222mg [Citrus clementina] gi|557529283|gb|ESR40533.1| hypothetical protein CICLE_v10026222mg [Citrus clementina] Length = 199 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/53 (71%), Positives = 45/53 (84%) Frame = -1 Query: 306 ITRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCPPFSDSEE 148 + RC +IGNLA EGGDRC+L+LVPGCMDPSS ++PLANVDDGSCP SD E+ Sbjct: 147 VDRCVLIGNLAAEGGDRCDLNLVPGCMDPSSPLYDPLANVDDGSCPLDSDIED 199 >ref|XP_006427292.1| hypothetical protein CICLE_v10026222mg [Citrus clementina] gi|557529282|gb|ESR40532.1| hypothetical protein CICLE_v10026222mg [Citrus clementina] Length = 283 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/53 (71%), Positives = 45/53 (84%) Frame = -1 Query: 306 ITRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCPPFSDSEE 148 + RC +IGNLA EGGDRC+L+LVPGCMDPSS ++PLANVDDGSCP SD E+ Sbjct: 231 VDRCVLIGNLAAEGGDRCDLNLVPGCMDPSSPLYDPLANVDDGSCPLDSDIED 283 >ref|XP_004506951.1| PREDICTED: uncharacterized protein LOC101496020 [Cicer arietinum] Length = 284 Score = 87.8 bits (216), Expect = 1e-15 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = -1 Query: 306 ITRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCPPFSDSE 151 I RCAM+GNL+ EGGDRC+L+LVPGC+DP+S F++PLANVDDGSCP DSE Sbjct: 230 IARCAMVGNLSKEGGDRCDLNLVPGCIDPNSPFYDPLANVDDGSCPIDVDSE 281 >ref|NP_001030706.1| post-illumination chlorophyll fluorescence increase protein [Arabidopsis thaliana] gi|332642212|gb|AEE75733.1| post-illumination chlorophyll fluorescence increase protein [Arabidopsis thaliana] Length = 265 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/53 (77%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = -1 Query: 303 TRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCP-PFSDSEE 148 TRC MI NL VEGGDRCNLDLVPGCMD +S FNP ANVDDGSCP SDS+E Sbjct: 213 TRCTMIANLTVEGGDRCNLDLVPGCMDTNSEHFNPYANVDDGSCPLELSDSDE 265 >ref|NP_566528.1| post-illumination chlorophyll fluorescence increase protein [Arabidopsis thaliana] gi|11994356|dbj|BAB02315.1| unnamed protein product [Arabidopsis thaliana] gi|14334704|gb|AAK59530.1| unknown protein [Arabidopsis thaliana] gi|22136938|gb|AAM91813.1| unknown protein [Arabidopsis thaliana] gi|332642211|gb|AEE75732.1| post-illumination chlorophyll fluorescence increase protein [Arabidopsis thaliana] Length = 268 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/53 (77%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = -1 Query: 303 TRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCP-PFSDSEE 148 TRC MI NL VEGGDRCNLDLVPGCMD +S FNP ANVDDGSCP SDS+E Sbjct: 216 TRCTMIANLTVEGGDRCNLDLVPGCMDTNSEHFNPYANVDDGSCPLELSDSDE 268 >ref|NP_001189904.1| post-illumination chlorophyll fluorescence increase protein [Arabidopsis thaliana] gi|332642215|gb|AEE75736.1| post-illumination chlorophyll fluorescence increase protein [Arabidopsis thaliana] Length = 248 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/53 (77%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = -1 Query: 303 TRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCP-PFSDSEE 148 TRC MI NL VEGGDRCNLDLVPGCMD +S FNP ANVDDGSCP SDS+E Sbjct: 196 TRCTMIANLTVEGGDRCNLDLVPGCMDTNSEHFNPYANVDDGSCPLELSDSDE 248 >ref|XP_002885111.1| hypothetical protein ARALYDRAFT_897884 [Arabidopsis lyrata subsp. lyrata] gi|297330951|gb|EFH61370.1| hypothetical protein ARALYDRAFT_897884 [Arabidopsis lyrata subsp. lyrata] Length = 268 Score = 87.8 bits (216), Expect = 1e-15 Identities = 41/53 (77%), Positives = 43/53 (81%), Gaps = 1/53 (1%) Frame = -1 Query: 303 TRCAMIGNLAVEGGDRCNLDLVPGCMDPSSTFFNPLANVDDGSCP-PFSDSEE 148 TRC MI NL VEGGDRCNLDLVPGCMD +S FNP ANVDDGSCP SDS+E Sbjct: 216 TRCTMIANLTVEGGDRCNLDLVPGCMDTNSEHFNPYANVDDGSCPLELSDSDE 268