BLASTX nr result
ID: Scutellaria24_contig00033629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00033629 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001190226.1| UDP-glycosyltransferase family protein [Arab... 113 2e-23 emb|CAB85554.1| putative protein [Arabidopsis thaliana] 113 2e-23 ref|NP_568137.1| UDP-glycosyltransferase family protein [Arabido... 113 2e-23 ref|XP_002873152.1| hypothetical protein ARALYDRAFT_487229 [Arab... 112 2e-23 ref|XP_002532918.1| transferase, transferring glycosyl groups, p... 112 4e-23 >ref|NP_001190226.1| UDP-glycosyltransferase family protein [Arabidopsis thaliana] gi|332003368|gb|AED90751.1| UDP-glycosyltransferase family protein [Arabidopsis thaliana] Length = 1035 Score = 113 bits (282), Expect = 2e-23 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = -1 Query: 167 WEEIYRNARKAEKLRFEPNERDEGELERTGQPICIYEMYNGAGGWPFLHHGSLYR 3 WEEIYRNARK+EKL+FE NERDEGELERTG+P+CIYE+YNGAG WPFLHHGSLYR Sbjct: 649 WEEIYRNARKSEKLKFEVNERDEGELERTGEPLCIYEIYNGAGAWPFLHHGSLYR 703 >emb|CAB85554.1| putative protein [Arabidopsis thaliana] Length = 1091 Score = 113 bits (282), Expect = 2e-23 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = -1 Query: 167 WEEIYRNARKAEKLRFEPNERDEGELERTGQPICIYEMYNGAGGWPFLHHGSLYR 3 WEEIYRNARK+EKL+FE NERDEGELERTG+P+CIYE+YNGAG WPFLHHGSLYR Sbjct: 705 WEEIYRNARKSEKLKFEVNERDEGELERTGEPLCIYEIYNGAGAWPFLHHGSLYR 759 >ref|NP_568137.1| UDP-glycosyltransferase family protein [Arabidopsis thaliana] gi|15450503|gb|AAK96544.1| AT5g04480/T32M21_80 [Arabidopsis thaliana] gi|24111433|gb|AAN46867.1| At5g04480/T32M21_80 [Arabidopsis thaliana] gi|332003367|gb|AED90750.1| UDP-glycosyltransferase family protein [Arabidopsis thaliana] Length = 1050 Score = 113 bits (282), Expect = 2e-23 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = -1 Query: 167 WEEIYRNARKAEKLRFEPNERDEGELERTGQPICIYEMYNGAGGWPFLHHGSLYR 3 WEEIYRNARK+EKL+FE NERDEGELERTG+P+CIYE+YNGAG WPFLHHGSLYR Sbjct: 664 WEEIYRNARKSEKLKFEVNERDEGELERTGEPLCIYEIYNGAGAWPFLHHGSLYR 718 >ref|XP_002873152.1| hypothetical protein ARALYDRAFT_487229 [Arabidopsis lyrata subsp. lyrata] gi|297318989|gb|EFH49411.1| hypothetical protein ARALYDRAFT_487229 [Arabidopsis lyrata subsp. lyrata] Length = 1051 Score = 112 bits (281), Expect = 2e-23 Identities = 48/55 (87%), Positives = 53/55 (96%) Frame = -1 Query: 167 WEEIYRNARKAEKLRFEPNERDEGELERTGQPICIYEMYNGAGGWPFLHHGSLYR 3 WEEIYRNARK+EKL+FE NERDEGELERTGQP+CIYE+Y+GAG WPFLHHGSLYR Sbjct: 665 WEEIYRNARKSEKLKFEVNERDEGELERTGQPVCIYEIYDGAGAWPFLHHGSLYR 719 >ref|XP_002532918.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223527311|gb|EEF29460.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 1020 Score = 112 bits (279), Expect = 4e-23 Identities = 47/55 (85%), Positives = 52/55 (94%) Frame = -1 Query: 167 WEEIYRNARKAEKLRFEPNERDEGELERTGQPICIYEMYNGAGGWPFLHHGSLYR 3 W+EIYRNARK+EKL+FE NERDEGELERTGQP+CIYE+YNG G WPFLHHGSLYR Sbjct: 640 WDEIYRNARKSEKLKFETNERDEGELERTGQPVCIYEIYNGPGAWPFLHHGSLYR 694