BLASTX nr result
ID: Scutellaria24_contig00033383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00033383 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331487.1| predicted protein [Populus trichocarpa] gi|2... 108 5e-22 ref|XP_004148898.1| PREDICTED: pentatricopeptide repeat-containi... 103 1e-20 ref|XP_003625322.1| Pentatricopeptide repeat protein [Medicago t... 96 3e-18 ref|XP_002443092.1| hypothetical protein SORBIDRAFT_08g008260 [S... 87 1e-15 ref|XP_003535630.1| PREDICTED: pentatricopeptide repeat-containi... 84 9e-15 >ref|XP_002331487.1| predicted protein [Populus trichocarpa] gi|222873565|gb|EEF10696.1| predicted protein [Populus trichocarpa] Length = 606 Score = 108 bits (270), Expect = 5e-22 Identities = 49/76 (64%), Positives = 61/76 (80%) Frame = -3 Query: 228 GTYVLLASLCANQRKWGDVRMARSMMRERGIKKTPGSSLIEVEGVFHEFLVGDESHPKSK 49 G YVLLA++CA+ R+WGDV+MAR MMRER +KK PG S++EVEG FHEFL GDESHP+S+ Sbjct: 526 GIYVLLANICASGRRWGDVKMARRMMRERRVKKIPGRSIVEVEGQFHEFLAGDESHPQSE 585 Query: 48 AIYKVLAELLLFSKLD 1 IY L +L SKL+ Sbjct: 586 GIYNALDQLFAMSKLE 601 >ref|XP_004148898.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like [Cucumis sativus] Length = 675 Score = 103 bits (257), Expect = 1e-20 Identities = 49/75 (65%), Positives = 58/75 (77%) Frame = -3 Query: 228 GTYVLLASLCANQRKWGDVRMARSMMRERGIKKTPGSSLIEVEGVFHEFLVGDESHPKSK 49 G Y LLA++CA+ +KW DVRM R MMRERG+KK PG SLIE+EG FHEFLV D SH +S Sbjct: 591 GIYSLLANICADGKKWKDVRMVRRMMRERGVKKVPGHSLIEIEGKFHEFLVADTSHTRSS 650 Query: 48 AIYKVLAELLLFSKL 4 IY+V+ ELLL S L Sbjct: 651 EIYRVVNELLLLSSL 665 >ref|XP_003625322.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355500337|gb|AES81540.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 1024 Score = 95.9 bits (237), Expect = 3e-18 Identities = 45/75 (60%), Positives = 57/75 (76%) Frame = -3 Query: 228 GTYVLLASLCANQRKWGDVRMARSMMRERGIKKTPGSSLIEVEGVFHEFLVGDESHPKSK 49 G YVLLA+ CAN RKW DVR RS+M+++G+KK PG SLIE++G F EFLV DESHP+S+ Sbjct: 695 GIYVLLANTCANDRKWSDVRRVRSLMKDKGVKKIPGYSLIEIDGGFVEFLVADESHPQSE 754 Query: 48 AIYKVLAELLLFSKL 4 IYK+ + L KL Sbjct: 755 EIYKLECDNLSSKKL 769 >ref|XP_002443092.1| hypothetical protein SORBIDRAFT_08g008260 [Sorghum bicolor] gi|241943785|gb|EES16930.1| hypothetical protein SORBIDRAFT_08g008260 [Sorghum bicolor] Length = 655 Score = 87.0 bits (214), Expect = 1e-15 Identities = 40/76 (52%), Positives = 54/76 (71%) Frame = -3 Query: 228 GTYVLLASLCANQRKWGDVRMARSMMRERGIKKTPGSSLIEVEGVFHEFLVGDESHPKSK 49 G YVL++ + A++ KWG V+M R++MR+RG+KK PG S IEV+G FHEFL D SH S+ Sbjct: 570 GIYVLMSQIYASKSKWGQVKMIRTVMRDRGVKKNPGCSSIEVDGKFHEFLAADVSHAHSE 629 Query: 48 AIYKVLAELLLFSKLD 1 IY L + L SKL+ Sbjct: 630 DIYAALENIYLHSKLE 645 >ref|XP_003535630.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010-like [Glycine max] Length = 595 Score = 84.3 bits (207), Expect = 9e-15 Identities = 37/66 (56%), Positives = 51/66 (77%) Frame = -3 Query: 228 GTYVLLASLCANQRKWGDVRMARSMMRERGIKKTPGSSLIEVEGVFHEFLVGDESHPKSK 49 G YVLL++L A +KW +VR R +M+++GI K PGSS+I V+G+ HEFLVGD SHP+S+ Sbjct: 513 GIYVLLSNLYATNKKWAEVRSVRRLMKQKGISKAPGSSIIRVDGMSHEFLVGDNSHPQSE 572 Query: 48 AIYKVL 31 IY +L Sbjct: 573 EIYVLL 578