BLASTX nr result
ID: Scutellaria24_contig00033206
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00033206 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514208.1| ATP binding protein, putative [Ricinus commu... 133 1e-29 ref|XP_003529059.1| PREDICTED: phosphoinositide 3-kinase regulat... 119 2e-25 ref|XP_004158421.1| PREDICTED: LOW QUALITY PROTEIN: phosphoinosi... 117 7e-25 ref|XP_004135676.1| PREDICTED: phosphoinositide 3-kinase regulat... 117 7e-25 ref|XP_002869433.1| kinase family protein [Arabidopsis lyrata su... 117 7e-25 >ref|XP_002514208.1| ATP binding protein, putative [Ricinus communis] gi|223546664|gb|EEF48162.1| ATP binding protein, putative [Ricinus communis] Length = 1455 Score = 133 bits (335), Expect = 1e-29 Identities = 69/92 (75%), Positives = 80/92 (86%), Gaps = 1/92 (1%) Frame = -1 Query: 273 ISLTEAGGLNE-NLSQKSSTLSANTSREPHKLNNDAHLAQLRKSIAEVIHELVMGPKQTP 97 ISL+EAG L+E NL++KS S+ TSR+ K+ ND+ LAQLRKSIAEV+ ELVMGPKQTP Sbjct: 620 ISLSEAGVLDEMNLARKSLASSSETSRQLQKVKNDSQLAQLRKSIAEVVQELVMGPKQTP 679 Query: 96 NIRRALLQDIGNLCWFFGQKQSNDFLLPILPA 1 NIRRALLQDIG LC+FFGQ+QSNDFLLPILPA Sbjct: 680 NIRRALLQDIGKLCYFFGQRQSNDFLLPILPA 711 >ref|XP_003529059.1| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Glycine max] Length = 1488 Score = 119 bits (299), Expect = 2e-25 Identities = 65/92 (70%), Positives = 72/92 (78%), Gaps = 1/92 (1%) Frame = -1 Query: 273 ISLTEAGGLNE-NLSQKSSTLSANTSREPHKLNNDAHLAQLRKSIAEVIHELVMGPKQTP 97 ISL+EAG L+E +L QK T S TS ++N DA L QLRKSIAEV+ ELVMGPKQTP Sbjct: 564 ISLSEAGVLDELSLPQKPLTSSTQTSGRMKRINGDAQLLQLRKSIAEVVQELVMGPKQTP 623 Query: 96 NIRRALLQDIGNLCWFFGQKQSNDFLLPILPA 1 NIRRALLQDIG LC FFG +QSND LLPILPA Sbjct: 624 NIRRALLQDIGKLCCFFGVRQSNDSLLPILPA 655 >ref|XP_004158421.1| PREDICTED: LOW QUALITY PROTEIN: phosphoinositide 3-kinase regulatory subunit 4-like [Cucumis sativus] Length = 1445 Score = 117 bits (294), Expect = 7e-25 Identities = 63/92 (68%), Positives = 74/92 (80%), Gaps = 1/92 (1%) Frame = -1 Query: 273 ISLTEAGGLNE-NLSQKSSTLSANTSREPHKLNNDAHLAQLRKSIAEVIHELVMGPKQTP 97 +S EAG L++ ++ QK S S+ TS + KL+ D LAQLRKSIAEV+ ELVMGPKQTP Sbjct: 612 MSFREAGVLDKLSIPQKPSAPSSETSGQLGKLHGDVQLAQLRKSIAEVVQELVMGPKQTP 671 Query: 96 NIRRALLQDIGNLCWFFGQKQSNDFLLPILPA 1 IRRALL+DIGNLC FFGQ+QSNDFLLPILPA Sbjct: 672 CIRRALLKDIGNLCCFFGQRQSNDFLLPILPA 703 >ref|XP_004135676.1| PREDICTED: phosphoinositide 3-kinase regulatory subunit 4-like [Cucumis sativus] Length = 1445 Score = 117 bits (294), Expect = 7e-25 Identities = 63/92 (68%), Positives = 74/92 (80%), Gaps = 1/92 (1%) Frame = -1 Query: 273 ISLTEAGGLNE-NLSQKSSTLSANTSREPHKLNNDAHLAQLRKSIAEVIHELVMGPKQTP 97 +S EAG L++ ++ QK S S+ TS + KL+ D LAQLRKSIAEV+ ELVMGPKQTP Sbjct: 612 MSFREAGVLDKLSIPQKPSAPSSETSGQLGKLHGDVQLAQLRKSIAEVVQELVMGPKQTP 671 Query: 96 NIRRALLQDIGNLCWFFGQKQSNDFLLPILPA 1 IRRALL+DIGNLC FFGQ+QSNDFLLPILPA Sbjct: 672 CIRRALLKDIGNLCCFFGQRQSNDFLLPILPA 703 >ref|XP_002869433.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] gi|297315269|gb|EFH45692.1| kinase family protein [Arabidopsis lyrata subsp. lyrata] Length = 1494 Score = 117 bits (294), Expect = 7e-25 Identities = 61/90 (67%), Positives = 71/90 (78%), Gaps = 1/90 (1%) Frame = -1 Query: 267 LTEAGGLNE-NLSQKSSTLSANTSREPHKLNNDAHLAQLRKSIAEVIHELVMGPKQTPNI 91 L++ G LNE N Q S T ++ T K N +A LAQLRK+IAEV+ ELVMGPKQTPN+ Sbjct: 570 LSDVGVLNELNSQQISPTPASETPSHLQKANGNAQLAQLRKTIAEVVQELVMGPKQTPNV 629 Query: 90 RRALLQDIGNLCWFFGQKQSNDFLLPILPA 1 RRALLQDIG LC+FFGQ+QSNDFLLPILPA Sbjct: 630 RRALLQDIGELCFFFGQRQSNDFLLPILPA 659