BLASTX nr result
ID: Scutellaria24_contig00033152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00033152 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532055.1| conserved hypothetical protein [Ricinus comm... 71 8e-11 ref|XP_003619486.1| Ribosomal protein-like protein [Medicago tru... 56 4e-06 >ref|XP_002532055.1| conserved hypothetical protein [Ricinus communis] gi|223528277|gb|EEF30327.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/60 (58%), Positives = 40/60 (66%) Frame = -2 Query: 255 MIVEDEGVEVTNWYDDENDGPLQYVGGPNQEFQDYLQRSFELLDNQVHHQLNADLTEHIW 76 MIVEDEG +TN DD+ D + P Q FQ YLQRS EL D +VHHQL +DL EHIW Sbjct: 1 MIVEDEGDAITNLDDDDKDTMILVNQAPVQGFQHYLQRSTELRDGEVHHQLRSDLVEHIW 60 >ref|XP_003619486.1| Ribosomal protein-like protein [Medicago truncatula] gi|355494501|gb|AES75704.1| Ribosomal protein-like protein [Medicago truncatula] Length = 386 Score = 55.8 bits (133), Expect = 4e-06 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 4/66 (6%) Frame = -2 Query: 255 MIVEDE----GVEVTNWYDDENDGPLQYVGGPNQEFQDYLQRSFELLDNQVHHQLNADLT 88 MIVEDE G +YD +GP N +FQ++L+R + + D Q+H QL DL Sbjct: 319 MIVEDERATYGGTFDYFYDHLGNGPTAPSDDSNNDFQEFLRRRYNIRDKQIHRQLQQDLI 378 Query: 87 EHIWAR 70 EHIW R Sbjct: 379 EHIWER 384