BLASTX nr result
ID: Scutellaria24_contig00033124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00033124 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533355.1| PREDICTED: pentatricopeptide repeat-containi... 83 3e-14 ref|XP_003622275.1| Pentatricopeptide repeat protein [Medicago t... 70 2e-10 ref|XP_003537434.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 ref|XP_002268072.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 gb|ADE77588.1| unknown [Picea sitchensis] 55 5e-06 >ref|XP_003533355.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Glycine max] Length = 540 Score = 82.8 bits (203), Expect = 3e-14 Identities = 39/70 (55%), Positives = 52/70 (74%) Frame = -1 Query: 324 CDLYAKSGRFDDQKTIRSLMKEKDVRKSVPGSSMIEVDGVVYEFSMKGSPEIPIEALQSI 145 CD+YAK+G FD K IR++MKEK + K +PG SMIE++G V EFS GS E+P++ L + Sbjct: 471 CDIYAKAGMFDAAKRIRNIMKEKRIEKKIPGCSMIEINGEVQEFSAGGSSELPMKELVLV 530 Query: 144 LMVLSNEMKL 115 L LSNEMK+ Sbjct: 531 LNGLSNEMKI 540 >ref|XP_003622275.1| Pentatricopeptide repeat protein [Medicago truncatula] gi|355497290|gb|AES78493.1| Pentatricopeptide repeat protein [Medicago truncatula] Length = 541 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/71 (47%), Positives = 50/71 (70%) Frame = -1 Query: 327 LCDLYAKSGRFDDQKTIRSLMKEKDVRKSVPGSSMIEVDGVVYEFSMKGSPEIPIEALQS 148 LCD+Y K+G++D K IR+ MKE+ + +PG S+IE++GVV EFS+ EIP++ L Sbjct: 474 LCDIYVKAGKYDAAKRIRNSMKERGIETKIPGCSIIEINGVVQEFSV---GEIPMKELPL 530 Query: 147 ILMVLSNEMKL 115 +L L NEMK+ Sbjct: 531 VLDRLRNEMKI 541 >ref|XP_003537434.1| PREDICTED: pentatricopeptide repeat-containing protein At5g48910-like [Glycine max] Length = 638 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/72 (38%), Positives = 46/72 (63%) Frame = -1 Query: 327 LCDLYAKSGRFDDQKTIRSLMKEKDVRKSVPGSSMIEVDGVVYEFSMKGSPEIPIEALQS 148 L ++YA SG +D +R +MK+ D+RK PG S IE+DGV++EF ++ + + S Sbjct: 475 LSNMYASSGNWDGVAAVRLMMKDMDIRKD-PGCSWIEIDGVIHEFLVEDDSHSRAKDIHS 533 Query: 147 ILMVLSNEMKLE 112 +L +SN++ LE Sbjct: 534 MLEEISNKLSLE 545 >ref|XP_002268072.1| PREDICTED: pentatricopeptide repeat-containing protein At4g38010-like [Vitis vinifera] Length = 590 Score = 56.6 bits (135), Expect = 2e-06 Identities = 30/73 (41%), Positives = 48/73 (65%) Frame = -1 Query: 330 ILCDLYAKSGRFDDQKTIRSLMKEKDVRKSVPGSSMIEVDGVVYEFSMKGSPEIPIEALQ 151 +L ++YA + R+DD +R LMK+K +RK PGSS+IEVDG +EF + + E + Sbjct: 513 LLSNIYATNERWDDVTRVRRLMKDKGIRK-FPGSSVIEVDGEAHEFLVGDTNHSRNEDIH 571 Query: 150 SILMVLSNEMKLE 112 +L +L+N++ LE Sbjct: 572 ILLNILANQVYLE 584 >gb|ADE77588.1| unknown [Picea sitchensis] Length = 312 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/71 (39%), Positives = 47/71 (66%) Frame = -1 Query: 330 ILCDLYAKSGRFDDQKTIRSLMKEKDVRKSVPGSSMIEVDGVVYEFSMKGSPEIPIEALQ 151 +L ++YA +GR+DD +R +MKEKDV+KS PG S+IEV+ ++ F + EA+ Sbjct: 148 LLSNIYAAAGRWDDVAKVRKMMKEKDVKKS-PGCSLIEVNNKLHSFVVGDISHPQTEAIY 206 Query: 150 SILMVLSNEMK 118 ++L L+ +M+ Sbjct: 207 AMLETLARQME 217