BLASTX nr result
ID: Scutellaria24_contig00033120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00033120 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147368.1| PREDICTED: cation/H(+) antiporter 15-like [C... 66 3e-09 ref|XP_002516306.1| Na(+)/H(+) antiporter, putative [Ricinus com... 65 4e-09 ref|NP_178985.1| cation/H(+) antiporter 15 [Arabidopsis thaliana... 64 2e-08 ref|XP_002883804.1| hypothetical protein ARALYDRAFT_480314 [Arab... 64 2e-08 ref|XP_002262677.2| PREDICTED: cation/H(+) antiporter 15-like [V... 63 3e-08 >ref|XP_004147368.1| PREDICTED: cation/H(+) antiporter 15-like [Cucumis sativus] gi|449513321|ref|XP_004164295.1| PREDICTED: cation/H(+) antiporter 15-like [Cucumis sativus] Length = 837 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/62 (45%), Positives = 43/62 (69%) Frame = +1 Query: 91 NQTILCYAETIYRFNGLWEGPDPLTPLISLFLIQLTFSMAVIHFLVYLLKPFNQPTFVAE 270 + TI+CYA T+ NG+W+G +PL + LF++QLT + + LV+LLKPF QP ++E Sbjct: 12 DDTIVCYAPTMITTNGVWQGDNPLDYSLPLFILQLTMVVVMTRILVFLLKPFRQPRVISE 71 Query: 271 VL 276 +L Sbjct: 72 IL 73 >ref|XP_002516306.1| Na(+)/H(+) antiporter, putative [Ricinus communis] gi|223544536|gb|EEF46053.1| Na(+)/H(+) antiporter, putative [Ricinus communis] Length = 834 Score = 65.5 bits (158), Expect = 4e-09 Identities = 27/64 (42%), Positives = 42/64 (65%) Frame = +1 Query: 85 TLNQTILCYAETIYRFNGLWEGPDPLTPLISLFLIQLTFSMAVIHFLVYLLKPFNQPTFV 264 T TI+CYA T+ NG+W+G +PL + LF++QLT + LV++LKPF QP + Sbjct: 12 TTEDTIVCYAPTMITTNGVWQGDNPLDYSLPLFILQLTLVVVTTRLLVFILKPFRQPRVI 71 Query: 265 AEVL 276 +E++ Sbjct: 72 SEIM 75 >ref|NP_178985.1| cation/H(+) antiporter 15 [Arabidopsis thaliana] gi|75313480|sp|Q9SIT5.1|CHX15_ARATH RecName: Full=Cation/H(+) antiporter 15; AltName: Full=Protein CATION/H+ EXCHANGER 15; Short=AtCHX15 gi|4558666|gb|AAD22684.1| putative Na/H antiporter [Arabidopsis thaliana] gi|61658321|gb|AAX49544.1| cation/H+ exchanger [Arabidopsis thaliana] gi|330251152|gb|AEC06246.1| cation/H(+) antiporter 15 [Arabidopsis thaliana] Length = 821 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/60 (43%), Positives = 42/60 (70%) Frame = +1 Query: 97 TILCYAETIYRFNGLWEGPDPLTPLISLFLIQLTFSMAVIHFLVYLLKPFNQPTFVAEVL 276 +I+CYA ++ NG+W+G +PL + LF++QLT + V F V++LKPF QP ++E+L Sbjct: 12 SIICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVVVTRFFVFILKPFRQPRVISEIL 71 >ref|XP_002883804.1| hypothetical protein ARALYDRAFT_480314 [Arabidopsis lyrata subsp. lyrata] gi|297329644|gb|EFH60063.1| hypothetical protein ARALYDRAFT_480314 [Arabidopsis lyrata subsp. lyrata] Length = 823 Score = 63.5 bits (153), Expect = 2e-08 Identities = 26/60 (43%), Positives = 42/60 (70%) Frame = +1 Query: 97 TILCYAETIYRFNGLWEGPDPLTPLISLFLIQLTFSMAVIHFLVYLLKPFNQPTFVAEVL 276 +I+CYA ++ NG+W+G +PL + LF++QLT + V F V++LKPF QP ++E+L Sbjct: 12 SIICYAPSMITTNGVWQGDNPLDFSLPLFVLQLTLVVVVTRFFVFILKPFRQPRVISEIL 71 >ref|XP_002262677.2| PREDICTED: cation/H(+) antiporter 15-like [Vitis vinifera] Length = 837 Score = 62.8 bits (151), Expect = 3e-08 Identities = 28/68 (41%), Positives = 45/68 (66%), Gaps = 3/68 (4%) Frame = +1 Query: 82 ATLNQT---ILCYAETIYRFNGLWEGPDPLTPLISLFLIQLTFSMAVIHFLVYLLKPFNQ 252 AT+N+T I+CY+ T+ NG+W+G +PL + LF++QLT + LV++LKP Q Sbjct: 6 ATVNRTDDMIVCYSPTMITTNGIWQGDNPLDYSLPLFILQLTLVVVTTRLLVFILKPLRQ 65 Query: 253 PTFVAEVL 276 P ++E+L Sbjct: 66 PRVISEIL 73