BLASTX nr result
ID: Scutellaria24_contig00033090
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00033090 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274411.1| PREDICTED: uncharacterized protein LOC100268... 66 3e-09 ref|XP_002323996.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 ref|XP_002521465.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|NP_198862.1| uncharacterized protein [Arabidopsis thaliana] ... 61 8e-08 dbj|BAB10495.1| unnamed protein product [Arabidopsis thaliana] 61 8e-08 >ref|XP_002274411.1| PREDICTED: uncharacterized protein LOC100268049 [Vitis vinifera] gi|147783376|emb|CAN59885.1| hypothetical protein VITISV_026167 [Vitis vinifera] Length = 103 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/51 (62%), Positives = 41/51 (80%), Gaps = 2/51 (3%) Frame = -1 Query: 165 MGFSKKHQIEAAKEPDGKKWVIAGIAIRAPLKPISTKVR--DDDDEESSTT 19 MGFS+K Q++ + E +GKKWVIAGI+IRAPL+P+STK R + DDE STT Sbjct: 1 MGFSEKPQVDGSIESEGKKWVIAGISIRAPLRPVSTKPREKESDDEACSTT 51 >ref|XP_002323996.1| predicted protein [Populus trichocarpa] gi|222866998|gb|EEF04129.1| predicted protein [Populus trichocarpa] Length = 106 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 4/53 (7%) Frame = -1 Query: 165 MGFSKKHQIEAAKEPDGKKWVIAGIAIRAPLKPISTKVR----DDDDEESSTT 19 MGFSKK Q+++ + +GKKWVIAGIAIR LKP++TK R D D+EE STT Sbjct: 1 MGFSKKTQVDSGLDSEGKKWVIAGIAIRTSLKPVNTKSRVKDCDGDEEEFSTT 53 >ref|XP_002521465.1| conserved hypothetical protein [Ricinus communis] gi|223539364|gb|EEF40955.1| conserved hypothetical protein [Ricinus communis] Length = 110 Score = 61.6 bits (148), Expect = 6e-08 Identities = 31/56 (55%), Positives = 39/56 (69%), Gaps = 7/56 (12%) Frame = -1 Query: 165 MGFSKKHQIEAAKEPDGKKWVIAGIAIRAPLKPISTKVR-------DDDDEESSTT 19 MGFSKK Q+++ + +GKKWVIAGIAIR LKPIST+ R DD +EE +T Sbjct: 1 MGFSKKSQVDSGLDSEGKKWVIAGIAIRTSLKPISTRPRAKASENGDDSEEEQCST 56 >ref|NP_198862.1| uncharacterized protein [Arabidopsis thaliana] gi|88900376|gb|ABD57500.1| At5g40460 [Arabidopsis thaliana] gi|332007167|gb|AED94550.1| uncharacterized protein [Arabidopsis thaliana] Length = 112 Score = 61.2 bits (147), Expect = 8e-08 Identities = 33/62 (53%), Positives = 39/62 (62%), Gaps = 13/62 (20%) Frame = -1 Query: 165 MGFSKKHQIEAAKEPDGKKWVIAGIAIRAPLKPISTKVRD-------------DDDEESS 25 MGFSKK Q E E DGKKWVIAGI+IRA LKP+ TK+R +++EE S Sbjct: 1 MGFSKKSQFEGGLESDGKKWVIAGISIRASLKPVKTKLRAPPEIVTEVEEDCYNEEEECS 60 Query: 24 TT 19 TT Sbjct: 61 TT 62 >dbj|BAB10495.1| unnamed protein product [Arabidopsis thaliana] Length = 118 Score = 61.2 bits (147), Expect = 8e-08 Identities = 33/62 (53%), Positives = 39/62 (62%), Gaps = 13/62 (20%) Frame = -1 Query: 165 MGFSKKHQIEAAKEPDGKKWVIAGIAIRAPLKPISTKVRD-------------DDDEESS 25 MGFSKK Q E E DGKKWVIAGI+IRA LKP+ TK+R +++EE S Sbjct: 1 MGFSKKSQFEGGLESDGKKWVIAGISIRASLKPVKTKLRAPPEIVTEVEEDCYNEEEECS 60 Query: 24 TT 19 TT Sbjct: 61 TT 62