BLASTX nr result
ID: Scutellaria24_contig00032846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00032846 (329 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003634404.1| PREDICTED: uncharacterized protein LOC100854... 56 3e-06 >ref|XP_003634404.1| PREDICTED: uncharacterized protein LOC100854126 [Vitis vinifera] Length = 234 Score = 56.2 bits (134), Expect = 3e-06 Identities = 32/84 (38%), Positives = 46/84 (54%), Gaps = 2/84 (2%) Frame = -3 Query: 270 GDNSIFQQPGN--LDHGRSRFSRRRNHKYEHLARSLRPTTHQAHLRFSGNSIHLHRRKVK 97 GD+ IF + ++ R R R+H+ HL +SLRP +HQ + S +S+H RR Sbjct: 138 GDSEIFSYNAHRPIEVRRPPSRRWRDHRASHLRKSLRPRSHQIRVGISRDSVHSSRRNSI 197 Query: 96 NSGEHTPLHHHIRVTRSSKFSRKG 25 + H IRVTR+SKF +KG Sbjct: 198 KHDNYINTVHGIRVTRTSKFVQKG 221