BLASTX nr result
ID: Scutellaria24_contig00032749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00032749 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004134351.1| PREDICTED: pentatricopeptide repeat-containi... 97 1e-18 ref|NP_187008.1| pentatricopeptide repeat-containing protein [Ar... 94 1e-17 ref|XP_002264194.2| PREDICTED: pentatricopeptide repeat-containi... 92 6e-17 emb|CBI39966.3| unnamed protein product [Vitis vinifera] 92 6e-17 emb|CAN83351.1| hypothetical protein VITISV_028907 [Vitis vinifera] 91 1e-16 >ref|XP_004134351.1| PREDICTED: pentatricopeptide repeat-containing protein At3g03580-like [Cucumis sativus] Length = 895 Score = 97.1 bits (240), Expect = 1e-18 Identities = 42/47 (89%), Positives = 43/47 (91%) Frame = -3 Query: 235 MKNLRVCGDCHTVTKYISKIMNREILVRDANRFHLFKDGTCSCRDHW 95 MKNLRVCGDCHTVTKYI+KIM REILVRDANRFH FKDG CSC DHW Sbjct: 849 MKNLRVCGDCHTVTKYITKIMQREILVRDANRFHRFKDGACSCGDHW 895 >ref|NP_187008.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75207453|sp|Q9SS60.1|PP210_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At3g03580 gi|6091764|gb|AAF03474.1|AC009327_13 hypothetical protein [Arabidopsis thaliana] gi|28393735|gb|AAO42278.1| unknown protein [Arabidopsis thaliana] gi|29824355|gb|AAP04138.1| unknown protein [Arabidopsis thaliana] gi|332640438|gb|AEE73959.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 882 Score = 94.0 bits (232), Expect = 1e-17 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -3 Query: 235 MKNLRVCGDCHTVTKYISKIMNREILVRDANRFHLFKDGTCSCRDHW 95 MKNLRVCGDCH VTK ISKI+ REILVRDANRFHLFKDGTCSC+D W Sbjct: 836 MKNLRVCGDCHEVTKLISKIVGREILVRDANRFHLFKDGTCSCKDRW 882 >ref|XP_002264194.2| PREDICTED: pentatricopeptide repeat-containing protein At3g03580-like [Vitis vinifera] Length = 889 Score = 91.7 bits (226), Expect = 6e-17 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 235 MKNLRVCGDCHTVTKYISKIMNREILVRDANRFHLFKDGTCSCRDHW 95 MKNLRVC DCHTVTKYISKI+ RE+LVRDANRFH+FKDG CSC D+W Sbjct: 843 MKNLRVCEDCHTVTKYISKIVQRELLVRDANRFHVFKDGACSCGDYW 889 >emb|CBI39966.3| unnamed protein product [Vitis vinifera] Length = 726 Score = 91.7 bits (226), Expect = 6e-17 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = -3 Query: 235 MKNLRVCGDCHTVTKYISKIMNREILVRDANRFHLFKDGTCSCRDHW 95 MKNLRVC DCHTVTKYISKI+ RE+LVRDANRFH+FKDG CSC D+W Sbjct: 680 MKNLRVCEDCHTVTKYISKIVQRELLVRDANRFHVFKDGACSCGDYW 726 >emb|CAN83351.1| hypothetical protein VITISV_028907 [Vitis vinifera] Length = 948 Score = 90.9 bits (224), Expect = 1e-16 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = -3 Query: 235 MKNLRVCGDCHTVTKYISKIMNREILVRDANRFHLFKDGTCSCRDHW 95 MKNLRVC DCHTVTKYISKI RE+LVRDANRFH+FKDG CSC D+W Sbjct: 902 MKNLRVCEDCHTVTKYISKIXQRELLVRDANRFHVFKDGACSCGDYW 948