BLASTX nr result
ID: Scutellaria24_contig00032623
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00032623 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284421.1| PREDICTED: uncharacterized protein LOC100244... 64 2e-08 emb|CAN80354.1| hypothetical protein VITISV_003142 [Vitis vinifera] 64 2e-08 ref|XP_002309642.1| predicted protein [Populus trichocarpa] gi|2... 59 4e-07 ref|XP_002531117.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 >ref|XP_002284421.1| PREDICTED: uncharacterized protein LOC100244942 [Vitis vinifera] Length = 317 Score = 63.5 bits (153), Expect = 2e-08 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 3/68 (4%) Frame = -3 Query: 196 RNKEYVKQLIHLLKYAIQERDEARIEFQNLLNKTTTTTS---FPSIPLFESDNNLLKPLK 26 +NKE +KQL+ LLK A QERDEAR + Q +LNK ++ P P + ++ L+KP K Sbjct: 41 KNKESIKQLLQLLKVAYQERDEARDQLQKILNKVMPSSPPEFLPLRPQLQPESPLIKPTK 100 Query: 25 PNSSITES 2 NSSITES Sbjct: 101 ANSSITES 108 >emb|CAN80354.1| hypothetical protein VITISV_003142 [Vitis vinifera] Length = 347 Score = 63.5 bits (153), Expect = 2e-08 Identities = 34/68 (50%), Positives = 45/68 (66%), Gaps = 3/68 (4%) Frame = -3 Query: 196 RNKEYVKQLIHLLKYAIQERDEARIEFQNLLNKTTTTTS---FPSIPLFESDNNLLKPLK 26 +NKE +KQL+ LLK A QERDEAR + Q +LNK ++ P P + ++ L+KP K Sbjct: 71 KNKESIKQLLQLLKVAYQERDEARDQLQKILNKVMPSSPPEFLPLRPQLQPESPLIKPTK 130 Query: 25 PNSSITES 2 NSSITES Sbjct: 131 ANSSITES 138 >ref|XP_002309642.1| predicted protein [Populus trichocarpa] gi|222855618|gb|EEE93165.1| predicted protein [Populus trichocarpa] Length = 225 Score = 58.9 bits (141), Expect = 4e-07 Identities = 34/68 (50%), Positives = 46/68 (67%), Gaps = 3/68 (4%) Frame = -3 Query: 196 RNKEYVKQLIHLLKYAIQERDEARIEFQNLLNK---TTTTTSFPSIPLFESDNNLLKPLK 26 ++KE V +LI++LK A QERDEA+ + QNLLNK + T P +P +S N L+ P + Sbjct: 28 KHKEDVGRLINMLKVASQERDEAKGQLQNLLNKLILSNPTELLPFLPQAQSGNPLVIPAR 87 Query: 25 PNSSITES 2 NSSITES Sbjct: 88 GNSSITES 95 >ref|XP_002531117.1| conserved hypothetical protein [Ricinus communis] gi|223529313|gb|EEF31282.1| conserved hypothetical protein [Ricinus communis] Length = 316 Score = 57.4 bits (137), Expect = 1e-06 Identities = 31/68 (45%), Positives = 47/68 (69%), Gaps = 3/68 (4%) Frame = -3 Query: 196 RNKEYVKQLIHLLKYAIQERDEARIEFQNLLNKTTTTTSF---PSIPLFESDNNLLKPLK 26 ++KE +K L+ LLK A +ERDEA+ + Q LL+K T+++ P IP + ++ L+ P+K Sbjct: 41 KHKEDMKHLLDLLKIAYRERDEAKDQLQKLLSKLMPTSTYELHPIIPQAQPESPLVLPMK 100 Query: 25 PNSSITES 2 NSSITES Sbjct: 101 ANSSITES 108