BLASTX nr result
ID: Scutellaria24_contig00032599
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00032599 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002518527.1| pentatricopeptide repeat-containing protein,... 77 1e-12 ref|XP_002305605.1| predicted protein [Populus trichocarpa] gi|2... 70 2e-10 ref|XP_002264956.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 >ref|XP_002518527.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223542372|gb|EEF43914.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 599 Score = 77.4 bits (189), Expect = 1e-12 Identities = 45/94 (47%), Positives = 60/94 (63%) Frame = -1 Query: 282 SAAAKMLRNRQSEKASEPKISTNSRVNPNPNWRIRIKQSQLVSQASTVLLQRHSKFWAPL 103 +A A+ML R++ S KIS WR RI+Q+QLVS+ ST+LLQR++ W PL Sbjct: 22 TARAQMLLFRKTYSTSTSKIS----------WRTRIQQNQLVSEISTILLQRNN--WIPL 69 Query: 102 LKPLKLTSIFTPSLFCQILHRIQNHPKICFDFFN 1 L+ L L+S TP LF QILH+ Q H +I +FFN Sbjct: 70 LQNLNLSSKLTPFLFFQILHKTQTHAQISLNFFN 103 >ref|XP_002305605.1| predicted protein [Populus trichocarpa] gi|222848569|gb|EEE86116.1| predicted protein [Populus trichocarpa] Length = 564 Score = 69.7 bits (169), Expect = 2e-10 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 2/73 (2%) Frame = -1 Query: 213 SRVNPNPN--WRIRIKQSQLVSQASTVLLQRHSKFWAPLLKPLKLTSIFTPSLFCQILHR 40 +R NP + WRI+I+Q+QLV Q S++LLQRH+ W LL+ L++ TP LF QILH+ Sbjct: 4 NRANPTTSMKWRIQIRQNQLVFQISSILLQRHN--WVSLLQNFNLSTKLTPPLFNQILHK 61 Query: 39 IQNHPKICFDFFN 1 Q +P+I FFN Sbjct: 62 TQTNPQISLRFFN 74 >ref|XP_002264956.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21170-like [Vitis vinifera] Length = 569 Score = 68.6 bits (166), Expect = 5e-10 Identities = 34/64 (53%), Positives = 45/64 (70%) Frame = -1 Query: 192 NWRIRIKQSQLVSQASTVLLQRHSKFWAPLLKPLKLTSIFTPSLFCQILHRIQNHPKICF 13 NWR +IKQ+QL+SQ S++LLQRH+ W LL+ L+S TPSLF QIL + Q +P+ Sbjct: 21 NWRAQIKQNQLISQISSILLQRHN--WVTLLRNFNLSSKLTPSLFHQILLKTQKNPQSSL 78 Query: 12 DFFN 1 FFN Sbjct: 79 SFFN 82