BLASTX nr result
ID: Scutellaria24_contig00032592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00032592 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524077.1| PREDICTED: putative clathrin assembly protei... 70 1e-10 ref|XP_002270803.1| PREDICTED: putative clathrin assembly protei... 69 3e-10 ref|XP_003532968.1| PREDICTED: putative clathrin assembly protei... 69 4e-10 ref|XP_002523765.1| clathrin assembly protein, putative [Ricinus... 68 9e-10 ref|XP_003626768.1| hypothetical protein MTR_8g008860 [Medicago ... 68 9e-10 >ref|XP_003524077.1| PREDICTED: putative clathrin assembly protein At1g03050-like [Glycine max] Length = 585 Score = 70.5 bits (171), Expect = 1e-10 Identities = 34/67 (50%), Positives = 46/67 (68%) Frame = -3 Query: 321 FAASLAIEAPTYVQISEFENKQRLFVQEQLMWRQISRNGMQGHVGLPNVQQHNSYQYIPA 142 FAASLA+ P YVQ+SE E KQRL ++EQ MW+Q +R+GMQG+V +Q +N+Y Sbjct: 517 FAASLAVAPPAYVQMSEIEKKQRLLMEEQEMWQQYARSGMQGNVAFTKLQPNNTYH---M 573 Query: 141 GSYVQTW 121 G Y Q + Sbjct: 574 GQYPQNY 580 >ref|XP_002270803.1| PREDICTED: putative clathrin assembly protein At1g03050-like [Vitis vinifera] Length = 582 Score = 69.3 bits (168), Expect = 3e-10 Identities = 29/50 (58%), Positives = 40/50 (80%) Frame = -3 Query: 321 FAASLAIEAPTYVQISEFENKQRLFVQEQLMWRQISRNGMQGHVGLPNVQ 172 FAASLA+ PTYVQ+SE E KQ+L ++EQ +W+Q +R+GM GH+G+P Q Sbjct: 520 FAASLAVAPPTYVQMSEMEKKQKLLMEEQFLWQQYARDGMPGHLGIPKFQ 569 >ref|XP_003532968.1| PREDICTED: putative clathrin assembly protein At1g03050-like [Glycine max] Length = 593 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/67 (46%), Positives = 44/67 (65%) Frame = -3 Query: 321 FAASLAIEAPTYVQISEFENKQRLFVQEQLMWRQISRNGMQGHVGLPNVQQHNSYQYIPA 142 FAASLA+ P+YVQ+SE E KQRL ++EQ+MW+Q ++ GMQG L + +N+ Sbjct: 522 FAASLAVAPPSYVQMSEMEKKQRLLLEEQMMWQQYAKEGMQGQAALAKLHSNNNNNNSYT 581 Query: 141 GSYVQTW 121 G Y Q + Sbjct: 582 GGYPQNY 588 >ref|XP_002523765.1| clathrin assembly protein, putative [Ricinus communis] gi|223536977|gb|EEF38614.1| clathrin assembly protein, putative [Ricinus communis] Length = 578 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/55 (58%), Positives = 42/55 (76%) Frame = -3 Query: 321 FAASLAIEAPTYVQISEFENKQRLFVQEQLMWRQISRNGMQGHVGLPNVQQHNSY 157 FAASL + P YVQ+S+ E KQ+L V+EQLMW+Q +R+GMQG VG+ +Q NSY Sbjct: 516 FAASLVVAPPPYVQMSDMEKKQKLLVEEQLMWQQYARDGMQGQVGITKLQP-NSY 569 >ref|XP_003626768.1| hypothetical protein MTR_8g008860 [Medicago truncatula] gi|355520790|gb|AET01244.1| hypothetical protein MTR_8g008860 [Medicago truncatula] Length = 588 Score = 67.8 bits (164), Expect = 9e-10 Identities = 33/65 (50%), Positives = 43/65 (66%) Frame = -3 Query: 321 FAASLAIEAPTYVQISEFENKQRLFVQEQLMWRQISRNGMQGHVGLPNVQQHNSYQYIPA 142 FAAS+ + P YVQ+SE E +QRL +EQ +W+Q ++NGMQG VG QQ NS Y+ Sbjct: 518 FAASMLVAPPAYVQMSEMETRQRLLAEEQAIWQQYAKNGMQGQVGFATQQQPNSNFYM-- 575 Query: 141 GSYVQ 127 G Y Q Sbjct: 576 GGYQQ 580