BLASTX nr result
ID: Scutellaria24_contig00032587
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00032587 (296 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_002511922.1| pentatricopeptide repeat-containing protein,... 62 5e-08 >ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Vitis vinifera] gi|297745328|emb|CBI40408.3| unnamed protein product [Vitis vinifera] Length = 765 Score = 68.6 bits (166), Expect = 5e-10 Identities = 38/86 (44%), Positives = 55/86 (63%), Gaps = 2/86 (2%) Frame = -2 Query: 256 VLKISRRLPNYENAFQFFSYVKTTPQLSDSTSLAF--QAVLEHAMRENKGSPGRLFELFS 83 +L+I+R L + A +FF++V+ DS L+F +AV EHA RE S +L +LF Sbjct: 90 LLQITRLLGSTAKALKFFNWVQANSPCQDSPLLSFTLEAVFEHASRE-PNSHNKLLDLFK 148 Query: 82 LSKEQRVPLSVNSGTLLLKCFCRANM 5 SK ++PLSVN+ TLL++CF RA M Sbjct: 149 TSKSHKIPLSVNAATLLIRCFGRAQM 174 >ref|XP_002511922.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549102|gb|EEF50591.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 346 Score = 62.0 bits (149), Expect = 5e-08 Identities = 35/86 (40%), Positives = 54/86 (62%), Gaps = 2/86 (2%) Frame = -2 Query: 256 VLKISRRLPNYENAFQFFSYVKTTPQLSDSTSLA--FQAVLEHAMRENKGSPGRLFELFS 83 + +I+RRLP+ A +F Y++ S++ L+ FQA+ E A REN S L+EL+ Sbjct: 95 LFQIARRLPSSSQALKFLKYLQNNFPTSNTQHLSSTFQAIFELASREND-SRTNLYELYK 153 Query: 82 LSKEQRVPLSVNSGTLLLKCFCRANM 5 +SKE +PL++NS TLLL+ F R + Sbjct: 154 VSKEWNIPLTINSATLLLRFFGRIGL 179