BLASTX nr result
ID: Scutellaria24_contig00032524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00032524 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAH59412.1| hypothetical protein [Plantago major] 56 4e-06 >emb|CAH59412.1| hypothetical protein [Plantago major] Length = 258 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 266 VYYRFNQ*GFHGIELQNKMAAHELYDDMKWFVN 168 V+YRFN GFHGIELQN AA ELYDD K+FVN Sbjct: 194 VFYRFNAGGFHGIELQNTTAAQELYDDFKYFVN 226