BLASTX nr result
ID: Scutellaria24_contig00032501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00032501 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279580.1| PREDICTED: probable leucine-rich repeat rece... 89 4e-16 ref|XP_003535720.1| PREDICTED: probable leucine-rich repeat rece... 79 5e-13 ref|XP_002535240.1| receptor kinase, putative [Ricinus communis]... 77 2e-12 ref|XP_003592627.1| Leucine-rich repeat receptor-like protein ki... 76 3e-12 ref|XP_004159291.1| PREDICTED: probable leucine-rich repeat rece... 76 3e-12 >ref|XP_002279580.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g68400-like [Vitis vinifera] Length = 671 Score = 89.0 bits (219), Expect = 4e-16 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = -3 Query: 322 MACAQPSPDQRPKMNYVVKMIEELRGVEVSPSRENLDSVSESPSGSEDTCRASE 161 MAC PSPDQRPKM+YVVKMIEE+RGVEVSPS E DSVS+SPS SEDTC S+ Sbjct: 618 MACTTPSPDQRPKMSYVVKMIEEIRGVEVSPSHETFDSVSDSPSVSEDTCGVSQ 671 >ref|XP_003535720.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g68400-like [Glycine max] Length = 672 Score = 78.6 bits (192), Expect = 5e-13 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -3 Query: 322 MACAQPSPDQRPKMNYVVKMIEELRGVEVSPSRENLDSVSESPSGSEDTC 173 M C P+PDQRP+M +V+KMIEELRGVEVSP ++LDSVSESPS SED C Sbjct: 618 MTCTAPAPDQRPRMTHVLKMIEELRGVEVSPCHDSLDSVSESPSLSEDAC 667 >ref|XP_002535240.1| receptor kinase, putative [Ricinus communis] gi|223523674|gb|EEF27142.1| receptor kinase, putative [Ricinus communis] Length = 260 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/54 (66%), Positives = 43/54 (79%) Frame = -3 Query: 322 MACAQPSPDQRPKMNYVVKMIEELRGVEVSPSRENLDSVSESPSGSEDTCRASE 161 MAC PDQRP++++VVKMIEE+RGVEVSP E DSVS+SP SEDTC AS+ Sbjct: 207 MACTASPPDQRPRISHVVKMIEEMRGVEVSPCHETYDSVSDSPCVSEDTCGASQ 260 >ref|XP_003592627.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula] gi|355481675|gb|AES62878.1| Leucine-rich repeat receptor-like protein kinase [Medicago truncatula] Length = 669 Score = 76.3 bits (186), Expect = 3e-12 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -3 Query: 322 MACAQPSPDQRPKMNYVVKMIEELRGVEVSPSRENLDSVSESPSGSEDTC 173 M+C SPDQRP+M++VVKMIEELRGVEVSP + +DSVS+SPS SED C Sbjct: 614 MSCTAASPDQRPRMSHVVKMIEELRGVEVSPCHDTMDSVSDSPSLSEDAC 663 >ref|XP_004159291.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At1g68400-like [Cucumis sativus] Length = 672 Score = 75.9 bits (185), Expect = 3e-12 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = -3 Query: 322 MACAQPSPDQRPKMNYVVKMIEELRGVEVSPSRENLDSVSESPSGSEDTC 173 +AC SPDQRPKMN+VVKMI+ELRGVEVSP + DSV+ESPS SE TC Sbjct: 617 LACTAASPDQRPKMNHVVKMIDELRGVEVSPFHDGSDSVTESPSVSEGTC 666