BLASTX nr result
ID: Scutellaria24_contig00032475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00032475 (346 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277885.1| PREDICTED: uncharacterized protein LOC100250... 81 1e-13 ref|XP_002308033.1| predicted protein [Populus trichocarpa] gi|2... 72 5e-11 ref|XP_002876423.1| hypothetical protein ARALYDRAFT_486196 [Arab... 67 1e-09 ref|NP_191309.2| uncharacterized protein [Arabidopsis thaliana] ... 67 2e-09 emb|CAB66107.1| hypothetical protein [Arabidopsis thaliana] 67 2e-09 >ref|XP_002277885.1| PREDICTED: uncharacterized protein LOC100250289 [Vitis vinifera] Length = 112 Score = 80.9 bits (198), Expect = 1e-13 Identities = 36/63 (57%), Positives = 41/63 (65%) Frame = +3 Query: 63 DTGHSTHRSIEXXXXXXXXXXXXXXXXXXXXRLCGGRHFGGSGEHDIEGWVERRCRSCID 242 + HSTHRSIE RLCGGRHFGG+GE+DIEGWVER+CRSCID Sbjct: 28 EPSHSTHRSIETLVVVLAVITIVGVIAGIIARLCGGRHFGGNGENDIEGWVERKCRSCID 87 Query: 243 GGV 251 GG+ Sbjct: 88 GGI 90 >ref|XP_002308033.1| predicted protein [Populus trichocarpa] gi|222854009|gb|EEE91556.1| predicted protein [Populus trichocarpa] Length = 116 Score = 72.0 bits (175), Expect = 5e-11 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 156 RLCGGRHFGGSGEHDIEGWVERRCRSCIDGGV 251 RLCGGRHFGG+GEHDIEGWVE RCR+CIDGG+ Sbjct: 55 RLCGGRHFGGNGEHDIEGWVESRCRNCIDGGI 86 >ref|XP_002876423.1| hypothetical protein ARALYDRAFT_486196 [Arabidopsis lyrata subsp. lyrata] gi|297322261|gb|EFH52682.1| hypothetical protein ARALYDRAFT_486196 [Arabidopsis lyrata subsp. lyrata] Length = 124 Score = 67.4 bits (163), Expect = 1e-09 Identities = 31/60 (51%), Positives = 34/60 (56%) Frame = +3 Query: 72 HSTHRSIEXXXXXXXXXXXXXXXXXXXXRLCGGRHFGGSGEHDIEGWVERRCRSCIDGGV 251 +S HRSIE RLCGGRH G+HDIEGWVER+CRSCID GV Sbjct: 34 NSDHRSIETLVVVLAVITILSVLAGVFARLCGGRHLSDGGDHDIEGWVERKCRSCIDAGV 93 >ref|NP_191309.2| uncharacterized protein [Arabidopsis thaliana] gi|55978805|gb|AAV68864.1| hypothetical protein AT3G57500 [Arabidopsis thaliana] gi|60547821|gb|AAX23874.1| hypothetical protein At3g57500 [Arabidopsis thaliana] gi|332646142|gb|AEE79663.1| uncharacterized protein [Arabidopsis thaliana] Length = 123 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/60 (50%), Positives = 34/60 (56%) Frame = +3 Query: 72 HSTHRSIEXXXXXXXXXXXXXXXXXXXXRLCGGRHFGGSGEHDIEGWVERRCRSCIDGGV 251 +S HRSIE RLCGGRH G+HDIEGWVER+CRSCID G+ Sbjct: 32 NSDHRSIETLVVVLAVITILSVLAGVFARLCGGRHLSHGGDHDIEGWVERKCRSCIDAGI 91 >emb|CAB66107.1| hypothetical protein [Arabidopsis thaliana] Length = 139 Score = 66.6 bits (161), Expect = 2e-09 Identities = 30/60 (50%), Positives = 34/60 (56%) Frame = +3 Query: 72 HSTHRSIEXXXXXXXXXXXXXXXXXXXXRLCGGRHFGGSGEHDIEGWVERRCRSCIDGGV 251 +S HRSIE RLCGGRH G+HDIEGWVER+CRSCID G+ Sbjct: 48 NSDHRSIETLVVVLAVITILSVLAGVFARLCGGRHLSHGGDHDIEGWVERKCRSCIDAGI 107