BLASTX nr result
ID: Scutellaria24_contig00032425
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00032425 (725 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containi... 77 4e-12 ref|XP_002527150.1| pentatricopeptide repeat-containing protein,... 73 7e-11 ref|XP_002884041.1| binding protein [Arabidopsis lyrata subsp. l... 70 3e-10 ref|XP_003530995.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|NP_179305.2| pentatricopeptide repeat-containing protein [Ar... 67 4e-09 >ref|XP_002279589.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140 [Vitis vinifera] gi|297744485|emb|CBI37747.3| unnamed protein product [Vitis vinifera] Length = 878 Score = 77.0 bits (188), Expect = 4e-12 Identities = 32/47 (68%), Positives = 39/47 (82%) Frame = +2 Query: 2 NDWQTILHRDDGSAIAMKTLKRVQKGWGHGNLSYSQAQKKDFLDDWD 142 +DWQTI+HRDDGS +A+K LKRVQKGWG G++S Q QK DFLD W+ Sbjct: 829 SDWQTIIHRDDGSGLALKALKRVQKGWGQGSISSLQPQKNDFLDYWE 875 >ref|XP_002527150.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223533489|gb|EEF35232.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 874 Score = 72.8 bits (177), Expect = 7e-11 Identities = 31/49 (63%), Positives = 37/49 (75%) Frame = +2 Query: 2 NDWQTILHRDDGSAIAMKTLKRVQKGWGHGNLSYSQAQKKDFLDDWDSA 148 NDW I+HRDDGS IA+K LKRVQKGWG G++S Q QK +F D WD + Sbjct: 825 NDWPIIVHRDDGSGIALKALKRVQKGWGQGSISSLQPQKLEFFDYWDGS 873 >ref|XP_002884041.1| binding protein [Arabidopsis lyrata subsp. lyrata] gi|297329881|gb|EFH60300.1| binding protein [Arabidopsis lyrata subsp. lyrata] Length = 874 Score = 70.5 bits (171), Expect = 3e-10 Identities = 29/47 (61%), Positives = 38/47 (80%) Frame = +2 Query: 2 NDWQTILHRDDGSAIAMKTLKRVQKGWGHGNLSYSQAQKKDFLDDWD 142 N+WQ ILHRDDGS IA+K+L RV+KGWG G++S Q Q+ D+LD W+ Sbjct: 825 NNWQNILHRDDGSGIALKSLSRVKKGWGQGDISSFQPQRVDYLDYWE 871 >ref|XP_003530995.1| PREDICTED: pentatricopeptide repeat-containing protein At2g17140-like [Glycine max] Length = 875 Score = 68.6 bits (166), Expect = 1e-09 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = +2 Query: 2 NDWQTILHRDDGSAIAMKTLKRVQKGWGHGNLSYSQAQKKDFLDDWDSA 148 +DWQ I++RD GS IA+KTLKRVQKGWG G++S Q Q+ DFLD +D + Sbjct: 826 SDWQDIINRDAGSGIALKTLKRVQKGWGQGSISSLQPQQNDFLDYYDGS 874 >ref|NP_179305.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|122223754|sp|Q0WPZ6.1|PP158_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g17140 gi|110737729|dbj|BAF00803.1| hypothetical protein [Arabidopsis thaliana] gi|330251496|gb|AEC06590.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 874 Score = 67.0 bits (162), Expect = 4e-09 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = +2 Query: 2 NDWQTILHRDDGSAIAMKTLKRVQKGWGHGNLSYSQAQKKDFLDDWD 142 N+WQ ILHRDDGS IA+++L RV+KGWG G++S Q + D+LD W+ Sbjct: 825 NNWQNILHRDDGSGIALRSLSRVKKGWGQGDISSFQPPRVDYLDYWE 871