BLASTX nr result
ID: Scutellaria24_contig00032366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00032366 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137590.1| PREDICTED: uncharacterized protein LOC101220... 60 2e-07 >ref|XP_004137590.1| PREDICTED: uncharacterized protein LOC101220892 [Cucumis sativus] gi|449487101|ref|XP_004157497.1| PREDICTED: uncharacterized LOC101220892 [Cucumis sativus] Length = 327 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/57 (50%), Positives = 40/57 (70%) Frame = +3 Query: 3 FVSPFTYSFLVFAKASVIRAFQDQKQPQELPISSWISLFNPIFTTQLCNSLLILTAN 173 F PFT +FL+ AKASVI+A ++ K + SS SL++PIF T +CNS+ IL+AN Sbjct: 88 FTIPFTLTFLLIAKASVIQALKETKSTSQPSFSSIKSLYSPIFLTNICNSIFILSAN 144