BLASTX nr result
ID: Scutellaria24_contig00032184
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00032184 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAW63130.1| 31 kDa putative protein [Strawberry latent ringsp... 95 5e-18 ref|NP_620833.1| 36 kDa protein [Strawberry latent ringspot viru... 65 5e-11 >gb|AAW63130.1| 31 kDa putative protein [Strawberry latent ringspot virus satellite RNA] Length = 287 Score = 95.1 bits (235), Expect = 5e-18 Identities = 43/77 (55%), Positives = 55/77 (71%) Frame = +3 Query: 3 HVEPFTWDNMSYGQCSRTLALYKQLTSCFGSKMFQATLYKEAVKKVCKLTDAVPVSIPEF 182 HV+P +W+ MS+GQCSR L LYKQL SCFG KMF ++LY AV+KV +L + PV+IPE Sbjct: 210 HVDPVSWEGMSFGQCSRALTLYKQLCSCFGVKMFSSSLYGMAVRKVLRLREDFPVAIPEN 269 Query: 183 MGRFGQVDFGAAPAHIY 233 R GQVD A H++ Sbjct: 270 FARLGQVDRDARAVHLF 286 >ref|NP_620833.1| 36 kDa protein [Strawberry latent ringspot virus satellite RNA] gi|478364|pir||JQ2018 hypothetical 36.5K protein - strawberry latent ringspot virus gi|312511|emb|CAA49480.1| 36 kDa protein [Strawberry latent ringspot virus satellite RNA] Length = 331 Score = 65.5 bits (158), Expect(2) = 5e-11 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +3 Query: 3 HVEPFTWDNMSYGQCSRTLALYKQLTSCFGSKMFQATLYKEAVKKVCKL 149 HV+P +W+ MS+GQCSR L LY+QL CFG KMF ++LY AV++ L Sbjct: 209 HVDPVSWEGMSFGQCSRALTLYRQLCGCFGMKMFSSSLYGMAVRRFSAL 257 Score = 26.6 bits (57), Expect(2) = 5e-11 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +1 Query: 226 TSIYSFCYCSGWVCAFL-GTWALFKESKVV 312 TS+YS+ S +V GTWA FK+S ++ Sbjct: 283 TSLYSYTSSSRFVPMIRSGTWAFFKDSLII 312