BLASTX nr result
ID: Scutellaria24_contig00032134
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00032134 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531073.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 >ref|XP_002531073.1| conserved hypothetical protein [Ricinus communis] gi|223529319|gb|EEF31287.1| conserved hypothetical protein [Ricinus communis] Length = 149 Score = 70.1 bits (170), Expect = 2e-10 Identities = 32/71 (45%), Positives = 54/71 (76%) Frame = -2 Query: 215 NLATRLVFTVGAHVLVQMIQILKVPGESSQRVLEQIRNMIQTCLEHLLDLIIEVINFVFS 36 NL +RL+F V A++LV +IQ L++PGE++ L+QI I+TC E++++L++E+I+ + S Sbjct: 18 NLVSRLIFRVTAYLLVLIIQGLRLPGEAAHGALQQIAEAIKTCFEYIMELVMEMISSIIS 77 Query: 35 SMFDLVKEGVS 3 S FDL+ E V+ Sbjct: 78 SSFDLLIEAVT 88