BLASTX nr result
ID: Scutellaria24_contig00031893
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00031893 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526975.1| conserved hypothetical protein [Ricinus comm... 63 2e-08 ref|XP_003633051.1| PREDICTED: uncharacterized protein LOC100854... 62 6e-08 >ref|XP_002526975.1| conserved hypothetical protein [Ricinus communis] gi|223533666|gb|EEF35402.1| conserved hypothetical protein [Ricinus communis] Length = 576 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = -3 Query: 260 NSSETQLPLKVVHQSGLKDEMRVFEIDRVTSRSTIEHLLQD 138 NS+ LPLKV+HQ GLKDEMRVFEID++TSR TIE LL++ Sbjct: 529 NSNALHLPLKVLHQPGLKDEMRVFEIDKITSRKTIERLLEE 569 >ref|XP_003633051.1| PREDICTED: uncharacterized protein LOC100854333 [Vitis vinifera] Length = 1689 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -3 Query: 260 NSSETQLPLKVVHQSGLKDEMRVFEIDRVTSRSTIEHLLQD 138 NS+ +QLPLKV+HQ GL+DEMR FE+D+VTSR TIE LL + Sbjct: 1642 NSNASQLPLKVLHQPGLRDEMRAFEVDQVTSRRTIEQLLDE 1682