BLASTX nr result
ID: Scutellaria24_contig00031890
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00031890 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002873698.1| proton-dependent oligopeptide transport fami... 68 9e-10 ref|NP_196998.1| major facilitator protein [Arabidopsis thaliana... 68 9e-10 ref|XP_003633812.1| PREDICTED: probable peptide/nitrate transpor... 64 1e-08 emb|CBI34989.3| unnamed protein product [Vitis vinifera] 64 1e-08 ref|NP_186784.1| putative peptide/nitrate transporter [Arabidops... 64 1e-08 >ref|XP_002873698.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] gi|297319535|gb|EFH49957.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] Length = 554 Score = 67.8 bits (164), Expect = 9e-10 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +3 Query: 3 TSSGGGRGNWFSDDMTQARLDKYYWFLAFSSAISLLAFVTFCRFCK 140 +SS GG+ NWF+DDMT+ARLD YYW LAF+SAIS L ++ C+ K Sbjct: 496 SSSRGGKHNWFADDMTEARLDNYYWLLAFTSAISFLMYIVICKHFK 541 >ref|NP_196998.1| major facilitator protein [Arabidopsis thaliana] gi|75174167|sp|Q9LFR1.1|PTR50_ARATH RecName: Full=Probable peptide/nitrate transporter At5g14940 gi|9755661|emb|CAC01813.1| oligopeptide transporter-like protein [Arabidopsis thaliana] gi|332004711|gb|AED92094.1| major facilitator protein [Arabidopsis thaliana] Length = 552 Score = 67.8 bits (164), Expect = 9e-10 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +3 Query: 3 TSSGGGRGNWFSDDMTQARLDKYYWFLAFSSAISLLAFVTFCRFCK 140 TSS GG+ NWF+DDM++ARLD YYW LAF+SAIS L ++ C+ K Sbjct: 494 TSSRGGKHNWFADDMSEARLDNYYWLLAFTSAISFLMYIVICKHFK 539 >ref|XP_003633812.1| PREDICTED: probable peptide/nitrate transporter At5g14940-like [Vitis vinifera] Length = 533 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +3 Query: 6 SSGGGRGNWFSDDMTQARLDKYYWFLAFSSAISLLAFVTFCRFCK 140 +S GGR WFSDDM +ARLDKYYW LA SS SLL ++ C++ K Sbjct: 480 TSSGGRQGWFSDDMREARLDKYYWLLALSSTFSLLLYMLLCKYYK 524 >emb|CBI34989.3| unnamed protein product [Vitis vinifera] Length = 549 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = +3 Query: 6 SSGGGRGNWFSDDMTQARLDKYYWFLAFSSAISLLAFVTFCRFCK 140 +S GGR WFSDDM +ARLDKYYW LA SS SLL ++ C++ K Sbjct: 480 TSSGGRQGWFSDDMREARLDKYYWLLALSSTFSLLLYMLLCKYYK 524 >ref|NP_186784.1| putative peptide/nitrate transporter [Arabidopsis thaliana] gi|75207342|sp|Q9SRI2.1|PTR31_ARATH RecName: Full=Putative peptide/nitrate transporter At3g01350 gi|6094559|gb|AAF03501.1|AC010676_11 putative peptide transporter [Arabidopsis thaliana] gi|332640133|gb|AEE73654.1| putative peptide/nitrate transporter [Arabidopsis thaliana] Length = 563 Score = 63.9 bits (154), Expect = 1e-08 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = +3 Query: 3 TSSGGGRGNWFSDDMTQARLDKYYWFLAFSSAISLLAFVTFCRFCK 140 +SS G R NWF+DDM++ARLDKYYW LA +S IS + ++ C+F K Sbjct: 504 SSSTGDRQNWFADDMSEARLDKYYWLLALTSTISFVVYIFLCKFFK 549