BLASTX nr result
ID: Scutellaria24_contig00031819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00031819 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002885043.1| hypothetical protein ARALYDRAFT_897714 [Arab... 58 7e-07 dbj|BAB01046.1| phosphate/phosphoenolpyruvate translocator prote... 57 2e-06 ref|NP_566487.1| Nucleotide/sugar transporter family protein [Ar... 57 2e-06 >ref|XP_002885043.1| hypothetical protein ARALYDRAFT_897714 [Arabidopsis lyrata subsp. lyrata] gi|297330883|gb|EFH61302.1| hypothetical protein ARALYDRAFT_897714 [Arabidopsis lyrata subsp. lyrata] Length = 339 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 176 MADWYRKWVREEFKTYAYILLYIALSSGQIFFNKW 280 MAD + ++R+EF TYAYILLYIALSSGQIFFNKW Sbjct: 1 MADRSKGFMRDEFVTYAYILLYIALSSGQIFFNKW 35 >dbj|BAB01046.1| phosphate/phosphoenolpyruvate translocator protein-like [Arabidopsis thaliana] Length = 339 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 176 MADWYRKWVREEFKTYAYILLYIALSSGQIFFNKW 280 MAD + ++R EF TYAYILLYIALSSGQIFFNKW Sbjct: 1 MADRSKGFMRAEFVTYAYILLYIALSSGQIFFNKW 35 >ref|NP_566487.1| Nucleotide/sugar transporter family protein [Arabidopsis thaliana] gi|75165421|sp|Q94EI9.1|PT314_ARATH RecName: Full=Probable sugar phosphate/phosphate translocator At3g14410 gi|15294190|gb|AAK95272.1|AF410286_1 AT3g14410/MLN21_19 [Arabidopsis thaliana] gi|20147279|gb|AAM10353.1| AT3g14410/MLN21_19 [Arabidopsis thaliana] gi|332641993|gb|AEE75514.1| Nucleotide/sugar transporter family protein [Arabidopsis thaliana] Length = 340 Score = 57.0 bits (136), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 176 MADWYRKWVREEFKTYAYILLYIALSSGQIFFNKW 280 MAD + ++R EF TYAYILLYIALSSGQIFFNKW Sbjct: 1 MADRSKGFMRAEFVTYAYILLYIALSSGQIFFNKW 35