BLASTX nr result
ID: Scutellaria24_contig00031791
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00031791 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_174491.1| uncharacterized protein [Arabidopsis thaliana] ... 63 3e-08 ref|XP_002519856.1| Transmembrane protein 45a, putative [Ricinus... 63 3e-08 gb|AAP45159.1| Plant viral-response family protein [Solanum bulb... 61 8e-08 ref|XP_002890968.1| hypothetical protein ARALYDRAFT_336289 [Arab... 59 3e-07 ref|XP_002326579.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 >ref|NP_174491.1| uncharacterized protein [Arabidopsis thaliana] gi|10801373|gb|AAG23445.1|AC084165_11 hypothetical protein [Arabidopsis thaliana] gi|332193316|gb|AEE31437.1| uncharacterized protein [Arabidopsis thaliana] Length = 1206 Score = 62.8 bits (151), Expect = 3e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = +3 Query: 237 KMGSFPGHVLPGTLFLVVGMWHMWCSIVRYIS 332 KMGSF GH LPGTLFLVVG+WH+W S+VRYIS Sbjct: 942 KMGSFKGHALPGTLFLVVGVWHIWSSVVRYIS 973 >ref|XP_002519856.1| Transmembrane protein 45a, putative [Ricinus communis] gi|223540902|gb|EEF42460.1| Transmembrane protein 45a, putative [Ricinus communis] Length = 278 Score = 62.8 bits (151), Expect = 3e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 240 MGSFPGHVLPGTLFLVVGMWHMWCSIVRYIS 332 MGSF GH LPG+LFL+VGMWH+WCS+VRY+S Sbjct: 1 MGSFKGHALPGSLFLLVGMWHIWCSLVRYVS 31 >gb|AAP45159.1| Plant viral-response family protein [Solanum bulbocastanum] gi|32470663|gb|AAP45189.1| Plant viral-response family protein [Solanum bulbocastanum] Length = 274 Score = 61.2 bits (147), Expect = 8e-08 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +3 Query: 240 MGSFPGHVLPGTLFLVVGMWHMWCSIVRYIS 332 MGSFPGHVLPGTLFLV+G+WH+W ++VRY S Sbjct: 1 MGSFPGHVLPGTLFLVIGVWHIWSALVRYSS 31 >ref|XP_002890968.1| hypothetical protein ARALYDRAFT_336289 [Arabidopsis lyrata subsp. lyrata] gi|297336810|gb|EFH67227.1| hypothetical protein ARALYDRAFT_336289 [Arabidopsis lyrata subsp. lyrata] Length = 264 Score = 59.3 bits (142), Expect = 3e-07 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +3 Query: 240 MGSFPGHVLPGTLFLVVGMWHMWCSIVRYIS 332 MGSF GH LPGTLFLVVG+WH+W S+VR+IS Sbjct: 1 MGSFKGHALPGTLFLVVGVWHIWSSVVRFIS 31 >ref|XP_002326579.1| predicted protein [Populus trichocarpa] gi|222833901|gb|EEE72378.1| predicted protein [Populus trichocarpa] Length = 265 Score = 58.5 bits (140), Expect = 5e-07 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +3 Query: 240 MGSFPGHVLPGTLFLVVGMWHMWCSIVRYIS 332 MGSF GH LPGTLFL+VG+WH+W S+VRY+S Sbjct: 1 MGSFKGHALPGTLFLLVGVWHIWSSLVRYLS 31