BLASTX nr result
ID: Scutellaria24_contig00031776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00031776 (349 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003538826.1| PREDICTED: pentatricopeptide repeat-containi... 70 2e-10 ref|XP_003540710.1| PREDICTED: pentatricopeptide repeat-containi... 66 3e-09 ref|XP_004157227.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 65 6e-09 ref|XP_003535453.1| PREDICTED: pentatricopeptide repeat-containi... 64 1e-08 ref|XP_003603587.1| Pentatricopeptide repeat-containing protein ... 64 1e-08 >ref|XP_003538826.1| PREDICTED: pentatricopeptide repeat-containing protein At3g50420-like [Glycine max] Length = 715 Score = 69.7 bits (169), Expect = 2e-10 Identities = 35/79 (44%), Positives = 49/79 (62%) Frame = -2 Query: 327 IELLKEQGGTSVLLSNMYANENEWSKVVQIRKEMRGRMQDKPPGRSWIQIKDAIFEFIAR 148 + L E G T VLLSN+YA +W KV +IR+ MRG M DK PG SWI+ K+ I F + Sbjct: 615 LRLKAEDGPTLVLLSNLYAAARKWDKVAEIRRNMRGLMLDKYPGLSWIEAKNDIHVFSSG 674 Query: 147 NEVDPLAMELHMVLEGIEK 91 ++ P A E+H L +++ Sbjct: 675 DQSHPKADEVHAELHRLKR 693 >ref|XP_003540710.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Glycine max] Length = 705 Score = 66.2 bits (160), Expect = 3e-09 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 1/83 (1%) Frame = -2 Query: 348 GKAVLAKI-ELLKEQGGTSVLLSNMYANENEWSKVVQIRKEMRGRMQDKPPGRSWIQIKD 172 GK V K+ E+ G VLLSNMYA W VV++RK+MR R K PG SWI+I+ Sbjct: 579 GKYVAEKLMEIDPLNSGPYVLLSNMYAELGRWKDVVRVRKQMRQRGVIKQPGCSWIEIQS 638 Query: 171 AIFEFIARNEVDPLAMELHMVLE 103 + F+ +++ PL ++H+VL+ Sbjct: 639 RVHVFMVKDKRHPLKKDIHLVLK 661 >ref|XP_004157227.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Cucumis sativus] Length = 863 Score = 65.1 bits (157), Expect = 6e-09 Identities = 26/79 (32%), Positives = 49/79 (62%) Frame = -2 Query: 327 IELLKEQGGTSVLLSNMYANENEWSKVVQIRKEMRGRMQDKPPGRSWIQIKDAIFEFIAR 148 + L E+ GT +LL+N+YA+ W V ++R+ M+ + K PG SWI++KD ++ FI Sbjct: 687 LTLEPEKSGTHILLANIYASTGMWDNVAKVRRSMKNSLVKKEPGMSWIELKDKVYTFIVG 746 Query: 147 NEVDPLAMELHMVLEGIEK 91 + P + E+++ L+ + + Sbjct: 747 DRSHPRSKEIYVKLDDLRE 765 >ref|XP_003535453.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Glycine max] Length = 782 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/80 (40%), Positives = 50/80 (62%) Frame = -2 Query: 327 IELLKEQGGTSVLLSNMYANENEWSKVVQIRKEMRGRMQDKPPGRSWIQIKDAIFEFIAR 148 +EL+ +Q GT + LSNMYA +W +V ++RK MR R K PG SWI++++ + F+ Sbjct: 606 LELMPQQDGTYISLSNMYAALGQWDEVARVRKLMRERGVKKEPGCSWIEVENMVHVFLVD 665 Query: 147 NEVDPLAMELHMVLEGIEKL 88 + V P E+H V +E+L Sbjct: 666 DAVHP---EVHAVYRYLEQL 682 >ref|XP_003603587.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355492635|gb|AES73838.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 568 Score = 64.3 bits (155), Expect = 1e-08 Identities = 31/82 (37%), Positives = 49/82 (59%) Frame = -2 Query: 342 AVLAKIELLKEQGGTSVLLSNMYANENEWSKVVQIRKEMRGRMQDKPPGRSWIQIKDAIF 163 AV +EL E+ G VLL+NMYA +W V IRK +R + K PG S I++ + + Sbjct: 434 AVKQLMELEPEESGNYVLLANMYAEHGKWEDVSNIRKLIRNKRIKKTPGSSSIEVNNVVQ 493 Query: 162 EFIARNEVDPLAMELHMVLEGI 97 EF++ ++ P + E+ +LEG+ Sbjct: 494 EFVSSDDSKPFSQEVFWILEGL 515