BLASTX nr result
ID: Scutellaria24_contig00031562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00031562 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553114.1| PREDICTED: beta-catenin-like protein 1-like ... 41 4e-06 >ref|XP_003553114.1| PREDICTED: beta-catenin-like protein 1-like [Glycine max] Length = 528 Score = 40.8 bits (94), Expect(2) = 4e-06 Identities = 24/46 (52%), Positives = 27/46 (58%) Frame = +2 Query: 104 IDLSLLEALEKSQQNAIETXXXXXXXXXXXXXERRLNANTAARLKY 241 +DLSLLEA+EKSQ NA+E ERRL N ARLKY Sbjct: 30 VDLSLLEAIEKSQ-NAVEALDLRALKKHVLSFERRLKDNIEARLKY 74 Score = 34.7 bits (78), Expect(2) = 4e-06 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = +1 Query: 241 PRQSDKFADSELELHDELQ 297 P Q D+FADSE+ELH+ELQ Sbjct: 75 PNQPDRFADSEVELHEELQ 93