BLASTX nr result
ID: Scutellaria24_contig00031455
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00031455 (334 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510040.1| transferase, transferring glycosyl groups, p... 82 4e-14 gb|AFZ78584.1| cellulose synthase-like protein [Populus tomentosa] 80 2e-13 ref|XP_002307301.1| predicted protein [Populus trichocarpa] gi|2... 80 2e-13 gb|AFZ78583.1| cellulose synthase-like protein [Populus tomentosa] 79 4e-13 ref|XP_002302382.1| predicted protein [Populus trichocarpa] gi|2... 79 4e-13 >ref|XP_002510040.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223550741|gb|EEF52227.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 696 Score = 82.0 bits (201), Expect = 4e-14 Identities = 41/64 (64%), Positives = 50/64 (78%), Gaps = 3/64 (4%) Frame = -2 Query: 183 MAP---WWSKESQR*TPVVVKMENPNNWAMVELESPSDEEFIYTNDAVSKGGRNRNAKQL 13 MAP WW+KE + TPVVVKMENP NW+MVELE PSDE+F+ D+ S+ RN+NAKQL Sbjct: 1 MAPSFDWWAKEGHKGTPVVVKMENP-NWSMVELEGPSDEDFLIAGDSPSR-RRNKNAKQL 58 Query: 12 TWVI 1 TWV+ Sbjct: 59 TWVL 62 >gb|AFZ78584.1| cellulose synthase-like protein [Populus tomentosa] Length = 701 Score = 80.1 bits (196), Expect = 2e-13 Identities = 41/67 (61%), Positives = 50/67 (74%), Gaps = 6/67 (8%) Frame = -2 Query: 183 MAP---WWSKESQR*TPVVVKMENPNNWAMVELESPSDEEFIYTNDAVSKG---GRNRNA 22 MAP WW+K+S R TPVVVKMENP NW+MVELE PS+E+F+ T+ G RN+NA Sbjct: 1 MAPLFDWWAKDSHRGTPVVVKMENP-NWSMVELEGPSEEDFLITDSPSRLGRDKSRNKNA 59 Query: 21 KQLTWVI 1 KQLTWV+ Sbjct: 60 KQLTWVL 66 >ref|XP_002307301.1| predicted protein [Populus trichocarpa] gi|222856750|gb|EEE94297.1| predicted protein [Populus trichocarpa] Length = 701 Score = 80.1 bits (196), Expect = 2e-13 Identities = 41/67 (61%), Positives = 50/67 (74%), Gaps = 6/67 (8%) Frame = -2 Query: 183 MAP---WWSKESQR*TPVVVKMENPNNWAMVELESPSDEEFIYTNDAVSKG---GRNRNA 22 MAP WW+K+S R TPVVVKMENP NW+MVELE PS+E+F+ T+ G RN+NA Sbjct: 1 MAPLFDWWAKDSHRGTPVVVKMENP-NWSMVELEGPSEEDFLITDSPSRLGRDKSRNKNA 59 Query: 21 KQLTWVI 1 KQLTWV+ Sbjct: 60 KQLTWVL 66 >gb|AFZ78583.1| cellulose synthase-like protein [Populus tomentosa] Length = 701 Score = 79.0 bits (193), Expect = 4e-13 Identities = 40/67 (59%), Positives = 50/67 (74%), Gaps = 6/67 (8%) Frame = -2 Query: 183 MAP---WWSKESQR*TPVVVKMENPNNWAMVELESPSDEEFIYTNDAVSKG---GRNRNA 22 MAP WW+K+S + TPVVVKMENP NW+MVELE PS+E+F+ T+ G RN+NA Sbjct: 1 MAPSFDWWAKDSHKGTPVVVKMENP-NWSMVELEGPSEEDFLITDSPSRLGRDKSRNKNA 59 Query: 21 KQLTWVI 1 KQLTWV+ Sbjct: 60 KQLTWVL 66 >ref|XP_002302382.1| predicted protein [Populus trichocarpa] gi|222844108|gb|EEE81655.1| predicted protein [Populus trichocarpa] Length = 701 Score = 79.0 bits (193), Expect = 4e-13 Identities = 40/67 (59%), Positives = 50/67 (74%), Gaps = 6/67 (8%) Frame = -2 Query: 183 MAP---WWSKESQR*TPVVVKMENPNNWAMVELESPSDEEFIYTNDAVSKG---GRNRNA 22 MAP WW+K+S + TPVVVKMENP NW+MVELE PS+E+F+ T+ G RN+NA Sbjct: 1 MAPSFDWWAKDSHKGTPVVVKMENP-NWSMVELEGPSEEDFLITDSPSRLGRDKSRNKNA 59 Query: 21 KQLTWVI 1 KQLTWV+ Sbjct: 60 KQLTWVL 66