BLASTX nr result
ID: Scutellaria24_contig00031440
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00031440 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002459726.1| hypothetical protein SORBIDRAFT_02g009450 [S... 56 3e-06 ref|XP_002514932.1| conserved hypothetical protein [Ricinus comm... 56 3e-06 >ref|XP_002459726.1| hypothetical protein SORBIDRAFT_02g009450 [Sorghum bicolor] gi|241923103|gb|EER96247.1| hypothetical protein SORBIDRAFT_02g009450 [Sorghum bicolor] Length = 437 Score = 55.8 bits (133), Expect = 3e-06 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = +3 Query: 45 GSSATYPKMFGAQPSTPAFATPSSTPAFGTP-STPAFGTA 161 G+ +T P FGA STPAF TPSSTPAFGTP STPAFGTA Sbjct: 21 GTPSTTPA-FGATSSTPAFGTPSSTPAFGTPSSTPAFGTA 59 >ref|XP_002514932.1| conserved hypothetical protein [Ricinus communis] gi|223545983|gb|EEF47486.1| conserved hypothetical protein [Ricinus communis] Length = 395 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/39 (66%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = +3 Query: 45 GSSATYPKMFGAQPSTPAFATPSSTPAFGTP-STPAFGT 158 G+ ++ P +FG STP+F TPSSTPAFGTP STPAFGT Sbjct: 12 GTPSSTPSLFGTPSSTPSFGTPSSTPAFGTPSSTPAFGT 50