BLASTX nr result
ID: Scutellaria24_contig00031217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00031217 (267 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value pdb|3QKC|B Chain B, Crystal Structure Of Geranyl Diphosphate Syn... 97 2e-18 gb|AAS82859.1| geranyl diphosphate synthase small subunit [Antir... 97 2e-18 gb|AEZ55678.1| geranyl diphosphate synthase small subunit type I... 96 3e-18 gb|AAF08792.1|AF182827_1 geranyl diphosphate synthase small subu... 94 1e-17 pdb|3KRA|B Chain B, Mint Heterotetrameric Geranyl Pyrophosphate ... 94 1e-17 >pdb|3QKC|B Chain B, Crystal Structure Of Geranyl Diphosphate Synthase Small Subunit From Antirrhinum Majus gi|323463188|pdb|3QKC|A Chain A, Crystal Structure Of Geranyl Diphosphate Synthase Small Subunit From Antirrhinum Majus Length = 273 Score = 96.7 bits (239), Expect = 2e-18 Identities = 51/88 (57%), Positives = 65/88 (73%) Frame = +1 Query: 4 PNRRPTIQHKYGPNIELLTGDGIIPLGLELLAGSMDSARTCPNKILRVIKEITRAIGSQG 183 P + IQHK+ PNIELLTGDGIIP GLEL+A SMD R P++ILR I E+TR +GS+G Sbjct: 93 PMSKSEIQHKFDPNIELLTGDGIIPFGLELMARSMDPTRNNPDRILRAIIELTRVMGSEG 152 Query: 184 MIDGQYNESLGLGQHGIMTDVIELSEYV 267 +++GQY+E LGL Q + +EL EYV Sbjct: 153 IVEGQYHE-LGLNQ----LNDLELIEYV 175 >gb|AAS82859.1| geranyl diphosphate synthase small subunit [Antirrhinum majus] Length = 297 Score = 96.7 bits (239), Expect = 2e-18 Identities = 51/88 (57%), Positives = 65/88 (73%) Frame = +1 Query: 4 PNRRPTIQHKYGPNIELLTGDGIIPLGLELLAGSMDSARTCPNKILRVIKEITRAIGSQG 183 P + IQHK+ PNIELLTGDGIIP GLEL+A SMD R P++ILR I E+TR +GS+G Sbjct: 125 PMSKSEIQHKFDPNIELLTGDGIIPFGLELMARSMDPTRNNPDRILRAIIELTRVMGSEG 184 Query: 184 MIDGQYNESLGLGQHGIMTDVIELSEYV 267 +++GQY+E LGL Q + +EL EYV Sbjct: 185 IVEGQYHE-LGLNQ----LNDLELIEYV 207 >gb|AEZ55678.1| geranyl diphosphate synthase small subunit type I [Salvia miltiorrhiza] Length = 314 Score = 95.9 bits (237), Expect = 3e-18 Identities = 48/76 (63%), Positives = 56/76 (73%) Frame = +1 Query: 1 RPNRRPTIQHKYGPNIELLTGDGIIPLGLELLAGSMDSARTCPNKILRVIKEITRAIGSQ 180 RPN +P IQHKYGPNIELLTGDG+ G ELLAGS+ S P +ILRVI EI+RA GS+ Sbjct: 135 RPNSKPAIQHKYGPNIELLTGDGMASFGFELLAGSIRSDHPNPERILRVIIEISRASGSE 194 Query: 181 GMIDGQYNESLGLGQH 228 G+IDG Y E + QH Sbjct: 195 GIIDGFYREKEIVDQH 210 >gb|AAF08792.1|AF182827_1 geranyl diphosphate synthase small subunit [Mentha x piperita] gi|10637873|emb|CAC10560.1| gpp synthase small subunit [Mentha x piperita] Length = 313 Score = 94.0 bits (232), Expect = 1e-17 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 1/70 (1%) Frame = +1 Query: 1 RPNRRPTIQHKYGPNIELLTGDGIIPLGLELLAGSMDSART-CPNKILRVIKEITRAIGS 177 RP +P IQHKYGPN+ELLTGDGI+P G ELLAGS+D ART P++ILRVI EI+RA G Sbjct: 136 RPVSKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIEISRAGGP 195 Query: 178 QGMIDGQYNE 207 +GMI G + E Sbjct: 196 EGMISGLHRE 205 >pdb|3KRA|B Chain B, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Magnesium gi|289526779|pdb|3KRA|C Chain C, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Magnesium gi|289526782|pdb|3KRC|B Chain B, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Ipp gi|289526783|pdb|3KRC|C Chain C, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Ipp gi|289526786|pdb|3KRF|B Chain B, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Magnesium, Ipp, And Dmaspp (I) gi|289526787|pdb|3KRF|C Chain C, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Magnesium, Ipp, And Dmaspp (I) gi|289526790|pdb|3KRO|B Chain B, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Magnesium, Ipp, And Dmaspp (Ii) gi|289526791|pdb|3KRO|C Chain C, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Magnesium, Ipp, And Dmaspp (Ii) gi|289526794|pdb|3KRP|B Chain B, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Magnesium And Gpp gi|289526795|pdb|3KRP|C Chain C, Mint Heterotetrameric Geranyl Pyrophosphate Synthase In Complex With Magnesium And Gpp Length = 274 Score = 94.0 bits (232), Expect = 1e-17 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 1/70 (1%) Frame = +1 Query: 1 RPNRRPTIQHKYGPNIELLTGDGIIPLGLELLAGSMDSART-CPNKILRVIKEITRAIGS 177 RP +P IQHKYGPN+ELLTGDGI+P G ELLAGS+D ART P++ILRVI EI+RA G Sbjct: 89 RPVSKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIEISRAGGP 148 Query: 178 QGMIDGQYNE 207 +GMI G + E Sbjct: 149 EGMISGLHRE 158