BLASTX nr result
ID: Scutellaria24_contig00031077
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00031077 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004164914.1| PREDICTED: 26S protease regulatory subunit S... 121 7e-26 ref|XP_004152678.1| PREDICTED: 26S protease regulatory subunit S... 121 7e-26 ref|XP_002510441.1| 26S protease regulatory subunit S10b, putati... 121 7e-26 ref|XP_002510440.1| 26S protease regulatory subunit S10b, putati... 121 7e-26 ref|XP_002307679.1| predicted protein [Populus trichocarpa] gi|2... 121 7e-26 >ref|XP_004164914.1| PREDICTED: 26S protease regulatory subunit S10B homolog B-like [Cucumis sativus] Length = 398 Score = 121 bits (303), Expect = 7e-26 Identities = 60/61 (98%), Positives = 60/61 (98%) Frame = -2 Query: 262 VVLDMTTLTIMRALPREVDPAVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE 83 VVLDMTTLTIMRALPREVDP VYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE Sbjct: 103 VVLDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE 162 Query: 82 L 80 L Sbjct: 163 L 163 >ref|XP_004152678.1| PREDICTED: 26S protease regulatory subunit S10B homolog B-like [Cucumis sativus] gi|449515750|ref|XP_004164911.1| PREDICTED: 26S protease regulatory subunit S10B homolog B-like [Cucumis sativus] Length = 398 Score = 121 bits (303), Expect = 7e-26 Identities = 60/61 (98%), Positives = 60/61 (98%) Frame = -2 Query: 262 VVLDMTTLTIMRALPREVDPAVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE 83 VVLDMTTLTIMRALPREVDP VYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE Sbjct: 103 VVLDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE 162 Query: 82 L 80 L Sbjct: 163 L 163 >ref|XP_002510441.1| 26S protease regulatory subunit S10b, putative [Ricinus communis] gi|223551142|gb|EEF52628.1| 26S protease regulatory subunit S10b, putative [Ricinus communis] Length = 399 Score = 121 bits (303), Expect = 7e-26 Identities = 60/61 (98%), Positives = 60/61 (98%) Frame = -2 Query: 262 VVLDMTTLTIMRALPREVDPAVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE 83 VVLDMTTLTIMRALPREVDP VYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE Sbjct: 104 VVLDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE 163 Query: 82 L 80 L Sbjct: 164 L 164 >ref|XP_002510440.1| 26S protease regulatory subunit S10b, putative [Ricinus communis] gi|223551141|gb|EEF52627.1| 26S protease regulatory subunit S10b, putative [Ricinus communis] Length = 399 Score = 121 bits (303), Expect = 7e-26 Identities = 60/61 (98%), Positives = 60/61 (98%) Frame = -2 Query: 262 VVLDMTTLTIMRALPREVDPAVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE 83 VVLDMTTLTIMRALPREVDP VYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE Sbjct: 104 VVLDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE 163 Query: 82 L 80 L Sbjct: 164 L 164 >ref|XP_002307679.1| predicted protein [Populus trichocarpa] gi|222857128|gb|EEE94675.1| predicted protein [Populus trichocarpa] Length = 402 Score = 121 bits (303), Expect = 7e-26 Identities = 60/61 (98%), Positives = 60/61 (98%) Frame = -2 Query: 262 VVLDMTTLTIMRALPREVDPAVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE 83 VVLDMTTLTIMRALPREVDP VYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE Sbjct: 107 VVLDMTTLTIMRALPREVDPVVYNMLHEDPGNVSYSAVGGLSDQIRELRESIELPLMNPE 166 Query: 82 L 80 L Sbjct: 167 L 167