BLASTX nr result
ID: Scutellaria24_contig00031026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00031026 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002265429.1| PREDICTED: putative disease resistance prote... 79 5e-13 emb|CAN80064.1| hypothetical protein VITISV_035224 [Vitis vinifera] 78 6e-13 ref|XP_002267579.2| PREDICTED: putative disease resistance prote... 78 8e-13 emb|CAN67431.1| hypothetical protein VITISV_015133 [Vitis vinifera] 77 1e-12 ref|XP_002267622.2| PREDICTED: putative disease resistance RPP13... 77 2e-12 >ref|XP_002265429.1| PREDICTED: putative disease resistance protein At3g14460 [Vitis vinifera] Length = 1322 Score = 78.6 bits (192), Expect = 5e-13 Identities = 38/74 (51%), Positives = 49/74 (66%) Frame = -3 Query: 246 LLELHLEQCPKLQGDLPHYLPSLTKLVIIECEQLCSSLEGIPKIQEMELKGCSHVLLSSQ 67 L EL +E CPKL+GDLP +LP LT LVI+EC QL L P IQ++ LK C V+L S Sbjct: 874 LNELRIESCPKLKGDLPKHLPVLTSLVILECGQLVCQLPEAPSIQKLNLKECDEVVLRSV 933 Query: 66 LPTDSLTSLEIQNV 25 + S+T LE+ N+ Sbjct: 934 VHLPSITELEVSNI 947 >emb|CAN80064.1| hypothetical protein VITISV_035224 [Vitis vinifera] Length = 1289 Score = 78.2 bits (191), Expect = 6e-13 Identities = 38/74 (51%), Positives = 49/74 (66%) Frame = -3 Query: 246 LLELHLEQCPKLQGDLPHYLPSLTKLVIIECEQLCSSLEGIPKIQEMELKGCSHVLLSSQ 67 L EL +E CPKL+GDLP +LP LT LVI+EC QL L P IQ++ LK C V+L S Sbjct: 841 LNELRIEYCPKLKGDLPKHLPVLTSLVILECGQLVCQLPEAPSIQKLNLKECDEVVLRSV 900 Query: 66 LPTDSLTSLEIQNV 25 + S+T LE+ N+ Sbjct: 901 VHLPSITELEVSNI 914 >ref|XP_002267579.2| PREDICTED: putative disease resistance protein At3g14460-like [Vitis vinifera] Length = 1324 Score = 77.8 bits (190), Expect = 8e-13 Identities = 39/74 (52%), Positives = 48/74 (64%) Frame = -3 Query: 246 LLELHLEQCPKLQGDLPHYLPSLTKLVIIECEQLCSSLEGIPKIQEMELKGCSHVLLSSQ 67 L ELH+E C KL+GDLP +LP LT LVI+EC QL L P IQ + LK C V+L S Sbjct: 874 LNELHIECCAKLKGDLPKHLPLLTNLVILECGQLVCQLPKAPSIQHLNLKECDKVVLRSA 933 Query: 66 LPTDSLTSLEIQNV 25 + SLT LE+ N+ Sbjct: 934 VHMPSLTELEVSNI 947 >emb|CAN67431.1| hypothetical protein VITISV_015133 [Vitis vinifera] Length = 1237 Score = 77.0 bits (188), Expect = 1e-12 Identities = 37/75 (49%), Positives = 50/75 (66%) Frame = -3 Query: 249 TLLELHLEQCPKLQGDLPHYLPSLTKLVIIECEQLCSSLEGIPKIQEMELKGCSHVLLSS 70 +L EL +E CPKL+GDLP +LP LT LVI+EC QL L P IQ++ LK C V+L S Sbjct: 822 SLNELRIESCPKLKGDLPKHLPVLTSLVILECGQLVCQLPEAPSIQKLNLKECDEVVLRS 881 Query: 69 QLPTDSLTSLEIQNV 25 + S+T LE+ ++ Sbjct: 882 VVHLPSITELEVSDI 896 >ref|XP_002267622.2| PREDICTED: putative disease resistance RPP13-like protein 1-like [Vitis vinifera] Length = 1347 Score = 76.6 bits (187), Expect = 2e-12 Identities = 37/74 (50%), Positives = 48/74 (64%) Frame = -3 Query: 246 LLELHLEQCPKLQGDLPHYLPSLTKLVIIECEQLCSSLEGIPKIQEMELKGCSHVLLSSQ 67 L EL +E CPKL+GDLP +LP LT LVI+EC QL L P IQ++ LK C V+L S Sbjct: 899 LNELRIESCPKLKGDLPKHLPVLTSLVILECGQLVCQLPEAPSIQKLNLKECDEVVLRSV 958 Query: 66 LPTDSLTSLEIQNV 25 + S+ LE+ N+ Sbjct: 959 VHLPSINELEVSNI 972