BLASTX nr result
ID: Scutellaria24_contig00030897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00030897 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511500.1| conserved hypothetical protein [Ricinus comm... 77 2e-12 ref|XP_002266530.2| PREDICTED: uncharacterized protein LOC100244... 74 9e-12 emb|CBI15294.3| unnamed protein product [Vitis vinifera] 74 9e-12 ref|NP_177616.1| nodulin-like and major facilitator domain-conta... 72 5e-11 ref|XP_003528176.1| PREDICTED: uncharacterized protein LOC100799... 72 5e-11 >ref|XP_002511500.1| conserved hypothetical protein [Ricinus communis] gi|223550615|gb|EEF52102.1| conserved hypothetical protein [Ricinus communis] Length = 551 Score = 76.6 bits (187), Expect = 2e-12 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 168 IQCSCGASYAFGIYSPILKSTQGYDQSTLETVSVFKDIGVGADVL 302 IQCSCGASY FGIYS ILKS+Q YDQSTL+TVSVFKDIG A V+ Sbjct: 19 IQCSCGASYTFGIYSSILKSSQNYDQSTLDTVSVFKDIGANAGVI 63 >ref|XP_002266530.2| PREDICTED: uncharacterized protein LOC100244916 [Vitis vinifera] Length = 559 Score = 74.3 bits (181), Expect = 9e-12 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +3 Query: 168 IQCSCGASYAFGIYSPILKSTQGYDQSTLETVSVFKDIGVGADVL 302 IQC+CG SYAFG+YS +LKS+Q YDQ+TL+TVSVFKDIG A VL Sbjct: 15 IQCTCGGSYAFGVYSSVLKSSQSYDQATLDTVSVFKDIGANAGVL 59 >emb|CBI15294.3| unnamed protein product [Vitis vinifera] Length = 612 Score = 74.3 bits (181), Expect = 9e-12 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +3 Query: 168 IQCSCGASYAFGIYSPILKSTQGYDQSTLETVSVFKDIGVGADVL 302 IQC+CG SYAFG+YS +LKS+Q YDQ+TL+TVSVFKDIG A VL Sbjct: 15 IQCTCGGSYAFGVYSSVLKSSQSYDQATLDTVSVFKDIGANAGVL 59 >ref|NP_177616.1| nodulin-like and major facilitator domain-containing protein [Arabidopsis thaliana] gi|5882744|gb|AAD55297.1|AC008263_28 Strong similarity to gb|AF031243 nodule-specific protein (Nlj70) from Lotus japonicus and is a member of the PF|00083 Sugar (and other) transporter family. EST gb|Z37715 comes from this gene [Arabidopsis thaliana] gi|332197510|gb|AEE35631.1| nodulin-like and major facilitator domain-containing protein [Arabidopsis thaliana] Length = 533 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = +3 Query: 168 IQCSCGASYAFGIYSPILKSTQGYDQSTLETVSVFKDIGVGADV 299 IQC+ GASY FGIYS +LKSTQ YDQSTL+TVSVFKDIG A V Sbjct: 17 IQCASGASYTFGIYSAVLKSTQSYDQSTLDTVSVFKDIGANAGV 60 >ref|XP_003528176.1| PREDICTED: uncharacterized protein LOC100799596 [Glycine max] Length = 557 Score = 72.0 bits (175), Expect = 5e-11 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = +3 Query: 168 IQCSCGASYAFGIYSPILKSTQGYDQSTLETVSVFKDIGVGADVL 302 IQ SCGASY F IYS +LKSTQGYDQSTL+TVSVFKDIG VL Sbjct: 17 IQWSCGASYTFSIYSSVLKSTQGYDQSTLDTVSVFKDIGANFGVL 61