BLASTX nr result
ID: Scutellaria24_contig00030855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00030855 (263 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADI18733.1| hypothetical protein [uncultured Rhizobiales bact... 113 2e-23 ref|ZP_05822976.1| cell wall-associated hydrolase [Brucella abor... 89 4e-16 ref|ZP_12939398.1| hypothetical protein HMPREF9956_2590 [Staphyl... 87 1e-15 ref|ZP_06283573.1| conserved domain protein [Staphylococcus epid... 87 1e-15 ref|ZP_06284621.1| conserved domain protein [Staphylococcus epid... 87 1e-15 >gb|ADI18733.1| hypothetical protein [uncultured Rhizobiales bacterium HF4000_32B18] Length = 125 Score = 113 bits (282), Expect = 2e-23 Identities = 52/67 (77%), Positives = 56/67 (83%) Frame = +2 Query: 5 KLHALLHFHIRPINVVVFHGSQGNARFEVGFPLRCFQRLSRPYIAMLHCRWRDNSSTRGT 184 KLH LL FHI PINVVV++GSQG RF+VGFPLRCFQRLSRPY+A L C WR N STRGT Sbjct: 59 KLHTLLRFHIVPINVVVYNGSQGRTRFQVGFPLRCFQRLSRPYVATLQCGWRHNRSTRGT 118 Query: 185 FTPVLSY 205 TPVLSY Sbjct: 119 STPVLSY 125 >ref|ZP_05822976.1| cell wall-associated hydrolase [Brucella abortus NCTC 8038] gi|260565853|ref|ZP_05836335.1| cell wall-associated hydrolase [Brucella melitensis bv. 1 str. 16M] gi|261219758|ref|ZP_05934039.1| cell wall-associated hydrolase [Brucella ceti M13/05/1] gi|261313976|ref|ZP_05953173.1| cell wall-associated hydrolase [Brucella pinnipedialis M163/99/10] gi|261316146|ref|ZP_05955343.1| cell wall-associated hydrolase [Brucella pinnipedialis B2/94] gi|261322647|ref|ZP_05961844.1| cell wall-associated hydrolase [Brucella ceti M644/93/1] gi|265984660|ref|ZP_06097395.1| cell wall-associated hydrolase [Brucella sp. 83/13] gi|265996870|ref|ZP_06109427.1| cell wall-associated hydrolase [Brucella ceti M490/95/1] gi|260095405|gb|EEW79284.1| cell wall-associated hydrolase [Brucella abortus NCTC 8038] gi|260151029|gb|EEW86125.1| cell wall-associated hydrolase [Brucella melitensis bv. 1 str. 16M] gi|260924847|gb|EEX91415.1| cell wall-associated hydrolase [Brucella ceti M13/05/1] gi|261295337|gb|EEX98833.1| cell wall-associated hydrolase [Brucella ceti M644/93/1] gi|261295369|gb|EEX98865.1| cell wall-associated hydrolase [Brucella pinnipedialis B2/94] gi|261303002|gb|EEY06499.1| cell wall-associated hydrolase [Brucella pinnipedialis M163/99/10] gi|262551237|gb|EEZ07328.1| cell wall-associated hydrolase [Brucella ceti M490/95/1] gi|264663252|gb|EEZ33513.1| cell wall-associated hydrolase [Brucella sp. 83/13] Length = 152 Score = 89.0 bits (219), Expect = 4e-16 Identities = 42/52 (80%), Positives = 47/52 (90%) Frame = +1 Query: 106 MLSAVIPSVHSYAALPLARQQLHQRYVHPGPLVLGANPLNIPTPTADRDRTV 261 M SAVIPSV+SY A+ LA QQ+HQRYVHPGPLVLG +P+NIPTPTADRDRTV Sbjct: 1 MPSAVIPSVYSYPAMRLAPQQVHQRYVHPGPLVLGTDPVNIPTPTADRDRTV 52 >ref|ZP_12939398.1| hypothetical protein HMPREF9956_2590 [Staphylococcus epidermidis 14.1.R1.SE] gi|365232177|gb|EHM73188.1| hypothetical protein HMPREF9956_2590 [Staphylococcus epidermidis 14.1.R1.SE] Length = 105 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/52 (76%), Positives = 44/52 (84%) Frame = +1 Query: 106 MLSAVIPSVHSYAALPLARQQLHQRYVHPGPLVLGANPLNIPTPTADRDRTV 261 MLSA+IPS+HSY A+PLARQ +HQRYVHPGPLVL PL PTPT DRDRTV Sbjct: 1 MLSALIPSIHSYPAMPLARQLVHQRYVHPGPLVLRTAPLKFPTPTTDRDRTV 52 >ref|ZP_06283573.1| conserved domain protein [Staphylococcus epidermidis SK135] gi|281296523|gb|EFA89036.1| conserved domain protein [Staphylococcus epidermidis SK135] Length = 54 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/52 (76%), Positives = 44/52 (84%) Frame = +1 Query: 106 MLSAVIPSVHSYAALPLARQQLHQRYVHPGPLVLGANPLNIPTPTADRDRTV 261 MLSA+IPS+HSY A+PLARQ +HQRYVHPGPLVL PL PTPT DRDRTV Sbjct: 1 MLSALIPSIHSYPAMPLARQLVHQRYVHPGPLVLRTAPLKFPTPTTDRDRTV 52 >ref|ZP_06284621.1| conserved domain protein [Staphylococcus epidermidis SK135] gi|281294779|gb|EFA87306.1| conserved domain protein [Staphylococcus epidermidis SK135] Length = 55 Score = 87.4 bits (215), Expect = 1e-15 Identities = 40/52 (76%), Positives = 44/52 (84%) Frame = +1 Query: 106 MLSAVIPSVHSYAALPLARQQLHQRYVHPGPLVLGANPLNIPTPTADRDRTV 261 MLSA+IPS+HSY A+PLARQ +HQRYVHPGPLVL PL PTPT DRDRTV Sbjct: 1 MLSALIPSIHSYPAMPLARQLVHQRYVHPGPLVLRTAPLKFPTPTTDRDRTV 52