BLASTX nr result
ID: Scutellaria24_contig00030794
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00030794 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEI84329.1| lectin-domain receptor-like kinase [Nicotiana att... 72 7e-15 ref|XP_002525880.1| serine-threonine protein kinase, plant-type,... 75 9e-14 ref|XP_002525879.1| S-locus-specific glycoprotein precursor, put... 75 1e-13 ref|XP_002525876.1| serine-threonine protein kinase, plant-type,... 65 2e-12 ref|XP_002437131.1| hypothetical protein SORBIDRAFT_10g021740 [S... 55 1e-07 >gb|AEI84329.1| lectin-domain receptor-like kinase [Nicotiana attenuata] Length = 830 Score = 72.4 bits (176), Expect(2) = 7e-15 Identities = 35/68 (51%), Positives = 48/68 (70%), Gaps = 5/68 (7%) Frame = -3 Query: 239 SSFRFILVRGIFGWVYASGFYCTGSCDTYLFSIVVVHIDSNG-----AMSPPQVVWSANR 75 S+ R IL+RG FG YA GFYC G+C++Y+F+I +V +S A+ PQVVWSANR Sbjct: 52 STVRAILLRGTFGPRYACGFYCNGNCESYIFAIFIVQTNSISLITMPAIGFPQVVWSANR 111 Query: 74 DNPVRTNA 51 +NPV+ N+ Sbjct: 112 NNPVKINS 119 Score = 32.7 bits (73), Expect(2) = 7e-15 Identities = 13/22 (59%), Positives = 19/22 (86%) Frame = -1 Query: 67 LSEPMQLTAEGELALKDADGTL 2 ++ +QLTA+G+L L+DADGTL Sbjct: 117 INSTLQLTAQGDLVLRDADGTL 138 >ref|XP_002525880.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223534794|gb|EEF36484.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 837 Score = 74.7 bits (182), Expect(2) = 9e-14 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 5/68 (7%) Frame = -3 Query: 239 SSFRFILVRGIFGWVYASGFYCTGSCDTYLFSIVVVHIDS-----NGAMSPPQVVWSANR 75 S+ R IL+RG FG +A GF+C G+CD+YLF+I +V +S + A+ PQVVWSANR Sbjct: 56 STVRAILLRGTFGPRFACGFFCNGTCDSYLFAIFIVQTNSASYITSPAIGFPQVVWSANR 115 Query: 74 DNPVRTNA 51 +NPVR NA Sbjct: 116 NNPVRINA 123 Score = 26.6 bits (57), Expect(2) = 9e-14 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 67 LSEPMQLTAEGELALKDADGTL 2 ++ +Q T+ G+L LKD DGT+ Sbjct: 121 INATLQFTSGGDLILKDVDGTI 142 >ref|XP_002525879.1| S-locus-specific glycoprotein precursor, putative [Ricinus communis] gi|223534793|gb|EEF36483.1| S-locus-specific glycoprotein precursor, putative [Ricinus communis] Length = 457 Score = 74.7 bits (182), Expect(2) = 1e-13 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 5/68 (7%) Frame = -3 Query: 239 SSFRFILVRGIFGWVYASGFYCTGSCDTYLFSIVVVHIDS-----NGAMSPPQVVWSANR 75 S+ R IL+RG FG +A GF+C G+CD+YLF+I +V +S + A+ PQVVWSANR Sbjct: 56 STVRAILLRGTFGPRFACGFFCNGTCDSYLFAIFIVQTNSASYITSPAIGFPQVVWSANR 115 Query: 74 DNPVRTNA 51 +NPVR NA Sbjct: 116 NNPVRINA 123 Score = 26.6 bits (57), Expect(2) = 1e-13 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = -1 Query: 67 LSEPMQLTAEGELALKDADGTL 2 ++ +Q T+ G+L LKD DGT+ Sbjct: 121 INATLQFTSGGDLILKDVDGTI 142 >ref|XP_002525876.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223534790|gb|EEF36480.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 870 Score = 65.5 bits (158), Expect(2) = 2e-12 Identities = 33/76 (43%), Positives = 45/76 (59%), Gaps = 13/76 (17%) Frame = -3 Query: 239 SSFRFILVRGIFGWVYASGFYCTGSCDTYLFSIVVVH-------------IDSNGAMSPP 99 S+ R +LVRG G + GFYC G+C++YLF+I ++ +D+ P Sbjct: 58 STIRPVLVRGFLGPRFGCGFYCNGNCESYLFAIFIIQSELGPLFISPDAPVDTVLDFGFP 117 Query: 98 QVVWSANRDNPVRTNA 51 QVVWSANR+NPVR NA Sbjct: 118 QVVWSANRNNPVRINA 133 Score = 31.6 bits (70), Expect(2) = 2e-12 Identities = 12/22 (54%), Positives = 19/22 (86%) Frame = -1 Query: 67 LSEPMQLTAEGELALKDADGTL 2 ++ +QLT++G+L LKDADGT+ Sbjct: 131 INATLQLTSDGDLVLKDADGTI 152 >ref|XP_002437131.1| hypothetical protein SORBIDRAFT_10g021740 [Sorghum bicolor] gi|241915354|gb|EER88498.1| hypothetical protein SORBIDRAFT_10g021740 [Sorghum bicolor] Length = 840 Score = 54.7 bits (130), Expect(2) = 1e-07 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 6/55 (10%) Frame = -3 Query: 197 VYASGFYCTG---SCDTYLFSIVVVHIDSNGA---MSPPQVVWSANRDNPVRTNA 51 ++A GF+C G +CD Y+FSI +V+ S G + PQVVWSAN D PV+ NA Sbjct: 82 LFACGFFCAGLAATCDAYIFSIFIVNAFSIGDVLYLESPQVVWSANHDRPVKENA 136 Score = 26.2 bits (56), Expect(2) = 1e-07 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -1 Query: 55 MQLTAEGELALKDADGTL 2 +QLT G+L L DADGTL Sbjct: 138 VQLTELGDLVLYDADGTL 155