BLASTX nr result
ID: Scutellaria24_contig00030705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00030705 (243 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI29020.3| unnamed protein product [Vitis vinifera] 55 8e-06 >emb|CBI29020.3| unnamed protein product [Vitis vinifera] Length = 1606 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/67 (43%), Positives = 41/67 (61%) Frame = +1 Query: 40 FEQEVELYSLKELSLHGLEDTISQIWSRKVPIGHFFAVEKLHFCACNKLKHLFSPSIVTA 219 F Q+V L L+ LS+ GL D I +WS ++P F + KL CNKL +LF S+ +A Sbjct: 183 FSQQVALQGLESLSVRGL-DNIRALWSDQLPANSFSKLRKLQVRGCNKLLNLFLVSVASA 241 Query: 220 LVSLKEL 240 LV L++L Sbjct: 242 LVQLEDL 248