BLASTX nr result
ID: Scutellaria24_contig00030565
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00030565 (297 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301802.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002532735.1| hypothetical protein RCOM_1749890 [Ricinus c... 55 6e-06 >ref|XP_002301802.1| predicted protein [Populus trichocarpa] gi|222843528|gb|EEE81075.1| predicted protein [Populus trichocarpa] Length = 448 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/38 (73%), Positives = 30/38 (78%), Gaps = 6/38 (15%) Frame = +2 Query: 62 GQLCCLQAIKLSAGKMN------NLAKISKAIKGIGWL 157 GQLCCLQA+K SAGKMN NL KISKA+KGIGWL Sbjct: 399 GQLCCLQALKFSAGKMNLGMGRPNLVKISKALKGIGWL 436 >ref|XP_002532735.1| hypothetical protein RCOM_1749890 [Ricinus communis] gi|223527512|gb|EEF29637.1| hypothetical protein RCOM_1749890 [Ricinus communis] Length = 424 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/38 (71%), Positives = 30/38 (78%), Gaps = 6/38 (15%) Frame = +2 Query: 62 GQLCCLQAIKLSAGKMN------NLAKISKAIKGIGWL 157 GQLCCLQA+K SAGKM+ NL KISKA+KGIGWL Sbjct: 376 GQLCCLQALKFSAGKMSLGMGRPNLVKISKALKGIGWL 413