BLASTX nr result
ID: Scutellaria24_contig00030557
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00030557 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526513.1| protein binding protein, putative [Ricinus c... 58 7e-07 ref|XP_002298532.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_003527519.1| PREDICTED: sister chromatid cohesion protein... 55 8e-06 >ref|XP_002526513.1| protein binding protein, putative [Ricinus communis] gi|223534188|gb|EEF35904.1| protein binding protein, putative [Ricinus communis] Length = 396 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = -1 Query: 379 RVPGLSSEALLLKYTRRTQPTMEAEPVFSAR 287 +VPGLSSEALLLKYTRRTQP+++AEP+FSAR Sbjct: 366 KVPGLSSEALLLKYTRRTQPSLDAEPIFSAR 396 >ref|XP_002298532.1| predicted protein [Populus trichocarpa] gi|222845790|gb|EEE83337.1| predicted protein [Populus trichocarpa] Length = 393 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 379 RVPGLSSEALLLKYTRRTQPTMEAEPVFSAR 287 +VPGLSSE LLLKYTRRTQPT++A+PVFS+R Sbjct: 363 KVPGLSSEGLLLKYTRRTQPTLDADPVFSSR 393 >ref|XP_003527519.1| PREDICTED: sister chromatid cohesion protein DCC1-like [Glycine max] Length = 396 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 379 RVPGLSSEALLLKYTRRTQPTMEAEPVFSAR 287 ++PGLSSE LLLKYTRRTQP+ +AEPVFSAR Sbjct: 366 KLPGLSSEGLLLKYTRRTQPSADAEPVFSAR 396