BLASTX nr result
ID: Scutellaria24_contig00030380
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00030380 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513424.1| conserved hypothetical protein [Ricinus comm... 65 4e-09 gb|AAB70453.1| F19P19.16 [Arabidopsis thaliana] 61 8e-08 ref|NP_171934.1| BTB/POZ domain-containing protein [Arabidopsis ... 61 8e-08 sp|P93820.3|Y1439_ARATH RecName: Full=BTB/POZ domain-containing ... 61 8e-08 ref|XP_002892214.1| F19P19.16 [Arabidopsis lyrata subsp. lyrata]... 61 8e-08 >ref|XP_002513424.1| conserved hypothetical protein [Ricinus communis] gi|223547332|gb|EEF48827.1| conserved hypothetical protein [Ricinus communis] Length = 1016 Score = 65.5 bits (158), Expect = 4e-09 Identities = 37/71 (52%), Positives = 50/71 (70%), Gaps = 3/71 (4%) Frame = +3 Query: 129 QMRSSAKQGVADNNRGISGHVLTLHQRLYHALNLGS--WENKE-KWNSADIEIQRLVLRS 299 +MRS + G GISGH+ LH+RL+HAL+LG+ ++ KE KW DIEIQR V+RS Sbjct: 7 KMRSLKQSG------GISGHMSILHRRLHHALSLGTRVYDGKESKWQCTDIEIQRHVVRS 60 Query: 300 IDAFLECISSE 332 I +FL+CIS + Sbjct: 61 IASFLDCISGD 71 >gb|AAB70453.1| F19P19.16 [Arabidopsis thaliana] Length = 979 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 3/52 (5%) Frame = +3 Query: 180 SGHVLTLHQRLYHALNLGSW---ENKEKWNSADIEIQRLVLRSIDAFLECIS 326 + H+ TLH RLYHALNLG E ++KW DIEIQR V++SI AFL+C S Sbjct: 10 TAHINTLHHRLYHALNLGFRVCDEKEKKWKCTDIEIQRHVVKSISAFLDCFS 61 >ref|NP_171934.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] gi|332189570|gb|AEE27691.1| BTB/POZ domain-containing protein [Arabidopsis thaliana] Length = 849 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 3/52 (5%) Frame = +3 Query: 180 SGHVLTLHQRLYHALNLGSW---ENKEKWNSADIEIQRLVLRSIDAFLECIS 326 + H+ TLH RLYHALNLG E ++KW DIEIQR V++SI AFL+C S Sbjct: 10 TAHINTLHHRLYHALNLGFRVCDEKEKKWKCTDIEIQRHVVKSISAFLDCFS 61 >sp|P93820.3|Y1439_ARATH RecName: Full=BTB/POZ domain-containing protein At1g04390 Length = 1002 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 3/52 (5%) Frame = +3 Query: 180 SGHVLTLHQRLYHALNLGSW---ENKEKWNSADIEIQRLVLRSIDAFLECIS 326 + H+ TLH RLYHALNLG E ++KW DIEIQR V++SI AFL+C S Sbjct: 10 TAHINTLHHRLYHALNLGFRVCDEKEKKWKCTDIEIQRHVVKSISAFLDCFS 61 >ref|XP_002892214.1| F19P19.16 [Arabidopsis lyrata subsp. lyrata] gi|297338056|gb|EFH68473.1| F19P19.16 [Arabidopsis lyrata subsp. lyrata] Length = 978 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/52 (57%), Positives = 37/52 (71%), Gaps = 3/52 (5%) Frame = +3 Query: 180 SGHVLTLHQRLYHALNLGSW---ENKEKWNSADIEIQRLVLRSIDAFLECIS 326 + H+ TLH RLYHALNLG E ++KW DIEIQR V++SI AFL+C S Sbjct: 10 TAHINTLHHRLYHALNLGFRVCDEKEKKWKCTDIEIQRHVVKSISAFLDCFS 61