BLASTX nr result
ID: Scutellaria24_contig00030242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00030242 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003551494.1| PREDICTED: cytochrome P450 71D10-like [Glyci... 60 2e-07 ref|XP_003636955.1| Cytochrome P450 [Medicago truncatula] gi|355... 59 4e-07 gb|ABC59100.1| cytochrome P450 monooxygenase CYP71D70 [Medicago ... 58 9e-07 ref|XP_003617715.1| Cytochrome P450 [Medicago truncatula] gi|355... 58 9e-07 ref|XP_003615865.1| Cytochrome P450 [Medicago truncatula] gi|355... 58 9e-07 >ref|XP_003551494.1| PREDICTED: cytochrome P450 71D10-like [Glycine max] Length = 507 Score = 59.7 bits (143), Expect = 2e-07 Identities = 23/37 (62%), Positives = 31/37 (83%) Frame = +3 Query: 3 HFDWEMPNGKRCEQLDMEETIGMTTKRKHDLQLIPTL 113 HFDW MPNGK+ E+LDM E+ G++ +RKHDL LIP++ Sbjct: 465 HFDWNMPNGKKPEELDMSESFGLSVRRKHDLYLIPSI 501 >ref|XP_003636955.1| Cytochrome P450 [Medicago truncatula] gi|355502890|gb|AES84093.1| Cytochrome P450 [Medicago truncatula] Length = 411 Score = 58.9 bits (141), Expect = 4e-07 Identities = 22/40 (55%), Positives = 31/40 (77%) Frame = +3 Query: 3 HFDWEMPNGKRCEQLDMEETIGMTTKRKHDLQLIPTLKRP 122 HFDW+MPNG + ++LDM+E+ G+ +RKHDL L+PT P Sbjct: 372 HFDWKMPNGCKADELDMDESFGLAVRRKHDLWLVPTTYHP 411 >gb|ABC59100.1| cytochrome P450 monooxygenase CYP71D70 [Medicago truncatula] Length = 188 Score = 57.8 bits (138), Expect = 9e-07 Identities = 21/36 (58%), Positives = 28/36 (77%) Frame = +3 Query: 3 HFDWEMPNGKRCEQLDMEETIGMTTKRKHDLQLIPT 110 HFDW MPNG + LDM+E+ G+ +RKHDL+L+PT Sbjct: 147 HFDWRMPNGNNADDLDMDESFGLAVRRKHDLRLVPT 182 >ref|XP_003617715.1| Cytochrome P450 [Medicago truncatula] gi|355519050|gb|AET00674.1| Cytochrome P450 [Medicago truncatula] Length = 501 Score = 57.8 bits (138), Expect = 9e-07 Identities = 23/40 (57%), Positives = 31/40 (77%) Frame = +3 Query: 3 HFDWEMPNGKRCEQLDMEETIGMTTKRKHDLQLIPTLKRP 122 HFDW++PNG + E+LDM E+ G+ RKHDL LIP ++RP Sbjct: 462 HFDWKLPNGMKNEELDMTESFGLAVGRKHDLCLIPFIRRP 501 >ref|XP_003615865.1| Cytochrome P450 [Medicago truncatula] gi|355517200|gb|AES98823.1| Cytochrome P450 [Medicago truncatula] Length = 502 Score = 57.8 bits (138), Expect = 9e-07 Identities = 24/40 (60%), Positives = 30/40 (75%) Frame = +3 Query: 3 HFDWEMPNGKRCEQLDMEETIGMTTKRKHDLQLIPTLKRP 122 HFDW++PNG + E+LDM E+ GM RKHDL LIP +RP Sbjct: 463 HFDWKLPNGMKNEELDMTESFGMAIGRKHDLCLIPITRRP 502