BLASTX nr result
ID: Scutellaria24_contig00030095
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00030095 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI34673.3| unnamed protein product [Vitis vinifera] 61 1e-07 ref|XP_004159949.1| PREDICTED: tubulin beta-1 chain-like [Cucumi... 60 1e-07 ref|XP_004143909.1| PREDICTED: tubulin beta-1 chain-like [Cucumi... 60 1e-07 gb|AAD10493.1| beta-tubulin 6, partial [Triticum aestivum] 60 1e-07 ref|NP_001167653.1| uncharacterized protein LOC100381283 [Zea ma... 60 1e-07 >emb|CBI34673.3| unnamed protein product [Vitis vinifera] Length = 339 Score = 60.8 bits (146), Expect = 1e-07 Identities = 37/83 (44%), Positives = 43/83 (51%), Gaps = 10/83 (12%) Frame = +3 Query: 3 NADECMVLDNEALYDICFRTLKLTNPS--------CNPSFLITCIHPFLASL--DILTHT 152 NADECMVLDNEALYDICFRTLKLTNPS +TC F L D+ Sbjct: 159 NADECMVLDNEALYDICFRTLKLTNPSFGDLNHLISTTMSGVTCCLRFPGQLNSDLRKLA 218 Query: 153 SSA*YIPRLRFYEAFQQTVGLLC 221 + PRL F+ ++C Sbjct: 219 VNLIPFPRLHFFMQMWDAKNMMC 241 >ref|XP_004159949.1| PREDICTED: tubulin beta-1 chain-like [Cucumis sativus] Length = 445 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 3 NADECMVLDNEALYDICFRTLKLTNPS 83 NADECMVLDNEALYDICFRTLKLTNPS Sbjct: 195 NADECMVLDNEALYDICFRTLKLTNPS 221 >ref|XP_004143909.1| PREDICTED: tubulin beta-1 chain-like [Cucumis sativus] Length = 432 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 3 NADECMVLDNEALYDICFRTLKLTNPS 83 NADECMVLDNEALYDICFRTLKLTNPS Sbjct: 186 NADECMVLDNEALYDICFRTLKLTNPS 212 >gb|AAD10493.1| beta-tubulin 6, partial [Triticum aestivum] Length = 441 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 3 NADECMVLDNEALYDICFRTLKLTNPS 83 NADECMVLDNEALYDICFRTLKLTNPS Sbjct: 191 NADECMVLDNEALYDICFRTLKLTNPS 217 >ref|NP_001167653.1| uncharacterized protein LOC100381283 [Zea mays] gi|416145|gb|AAA19707.1| beta-4 tubulin [Zea mays] gi|194689110|gb|ACF78639.1| unknown [Zea mays] gi|194708284|gb|ACF88226.1| unknown [Zea mays] gi|413933508|gb|AFW68059.1| beta tubulin4 isoform 1 [Zea mays] gi|413933509|gb|AFW68060.1| beta tubulin4 isoform 2 [Zea mays] Length = 447 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +3 Query: 3 NADECMVLDNEALYDICFRTLKLTNPS 83 NADECMVLDNEALYDICFRTLKLTNPS Sbjct: 197 NADECMVLDNEALYDICFRTLKLTNPS 223