BLASTX nr result
ID: Scutellaria24_contig00030043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00030043 (412 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004940511.1| ycf3 gene product (chloroplast) [Boea hygrom... 91 1e-16 ref|YP_007507112.1| photosystem I assembly protein Ycf3 (chlorop... 89 3e-16 ref|YP_007353916.1| photosystem I assembly protein Ycf3 (chlorop... 89 4e-16 gb|AFB70727.1| photosystem I assembly protein Ycf3, partial (chl... 88 8e-16 gb|ADH94344.1| ycf3 protein [Syzygium cumini] 88 8e-16 >ref|YP_004940511.1| ycf3 gene product (chloroplast) [Boea hygrometrica] gi|340549408|gb|AEK53230.1| hypothetical chloroplast RF34 (chloroplast) [Boea hygrometrica] Length = 171 Score = 90.5 bits (223), Expect = 1e-16 Identities = 44/44 (100%), Positives = 44/44 (100%) Frame = +3 Query: 210 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKEAFTYYRDGVI 341 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKEAFTYYRDGVI Sbjct: 1 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKEAFTYYRDGVI 44 >ref|YP_007507112.1| photosystem I assembly protein Ycf3 (chloroplast) [Salvia miltiorrhiza] gi|401879743|gb|AFQ30930.1| photosystem I assembly protein Ycf3 (chloroplast) [Salvia miltiorrhiza] Length = 169 Score = 89.4 bits (220), Expect = 3e-16 Identities = 43/44 (97%), Positives = 44/44 (100%) Frame = +3 Query: 210 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKEAFTYYRDGVI 341 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKEAFTYYRDGV+ Sbjct: 1 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKEAFTYYRDGVM 44 >ref|YP_007353916.1| photosystem I assembly protein Ycf3 (chloroplast) [Tectona grandis] gi|438687605|emb|CCP47131.1| photosystem I assembly protein Ycf3 (chloroplast) [Tectona grandis] gi|438688289|emb|CCP47220.1| photosystem I assembly protein Ycf3 (chloroplast) [Tectona grandis] gi|438688413|emb|CCP47309.1| photosystem I assembly protein Ycf3 (chloroplast) [Tectona grandis] Length = 169 Score = 89.0 bits (219), Expect = 4e-16 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = +3 Query: 210 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKEAFTYYRDGVI 341 MPRSRINGNFIDKTFS+VANILLQIIPTTSGEKEAFTYYRDGV+ Sbjct: 1 MPRSRINGNFIDKTFSVVANILLQIIPTTSGEKEAFTYYRDGVM 44 >gb|AFB70727.1| photosystem I assembly protein Ycf3, partial (chloroplast) [Mollugo verticillata] Length = 217 Score = 87.8 bits (216), Expect = 8e-16 Identities = 42/44 (95%), Positives = 44/44 (100%) Frame = +3 Query: 210 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKEAFTYYRDGVI 341 MPRSRINGNFIDKTFSIVANILL+IIPTTSGEKEAFTYYRDGV+ Sbjct: 1 MPRSRINGNFIDKTFSIVANILLRIIPTTSGEKEAFTYYRDGVM 44 >gb|ADH94344.1| ycf3 protein [Syzygium cumini] Length = 168 Score = 87.8 bits (216), Expect = 8e-16 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = +3 Query: 210 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKEAFTYYRDGV 338 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKEAFTYYRDG+ Sbjct: 1 MPRSRINGNFIDKTFSIVANILLQIIPTTSGEKEAFTYYRDGM 43